WWW.DISSERS.RU

БЕСПЛАТНАЯ ЭЛЕКТРОННАЯ БИБЛИОТЕКА

   Добро пожаловать!


 

На правах рукописи

Хаитов Муса Рахимович

Новые иммунобиотехнологические методы

для профилактики и лечения вирус-ассоциированных

заболеваний

14.00.36 - аллергология и иммунология

А в т о р е ф е р а т

диссертации на соискание ученой степени

доктора медицинских наук

Москва, 2008

Работа выполнена в ГНЦ «Институт иммунологии ФМБА России»

Научный консультант:        

Академик РАН и РАМН Р.В. Петров

Официальные оппоненты: 

доктор биологических наук,

профессор, академик РАМН А.Л. Гинцбург

доктор медицинских наук,

профессор, академик РАМН В.И. Литвинов

доктор медицинских наук, профессор А.А. Ярилин

Ведущая организация: Российский государственный медицинский университет Федерального агентства по здравоохранению и социальному развитию.

Защита диссертации состоится « 24 » декабря 2008 г. в 14-00 часов на заседании Совета по защите докторских и кандидатских диссертаций Д 208.017.01 в ГНЦ «Институт иммунологии ФМБА России» по адресу: 115478, г. Москва, Каширское шоссе, дом 24, корпус 2. Тел/Факс: (495) 617-10-27

С диссертацией можно ознакомиться в библиотеке ГНЦ «Институт иммунологии ФМБА России».

Автореферат разослан «____» ____________ 2008 г.

Ученый секретарь

Совета по защите докторских и кандидатских диссертаций

доктор медицинских наук Л.С. Сеславина

Общая характеристика работы



Актуальность проблемы

Несмотря на то, что за последние годы была разработана эффективная противовирусная терапия для многих вирусных инфекций, количество вирус-ассоциированных заболеваний остается  высоким. Рак шейки матки, связанный с персистирующей инфекцией вирусом папилломы человека (HPV) - один из самых распространенных и опасных видов злокачественных новообразований у женщин во всем мире. По данным ВОЗ каждый год в мире диагностируется около 500 000 новых случаев рака шейки матки, который занимает второе место в мире как причина смерти от рака среди женщин. На сегодняшний день, по крайней мере, 700 миллионов человек являются носителями HPV-инфекции, а количество летальных исходов, связанных c HPV-инфекцией, достигает 280 тысяч в год (Waggoner S., 2003; Кулаков В.И.2000; Киселёв В.И, Киселёв О.И., 2003).

Наиболее частыми, до 90% всех случаев инфекционных заболеваний, являются острые респираторные вирусные инфекции (ОРВИ). В России ежегодно регистрируется от 27,3 до 41,2 млн. случаев этих заболеваний (Балаболкин И.И., 2003).

ОРВИ наносят огромный экономический ущерб за счет затраты больших средств на лечение как самого заболевания, так и вызванных им осложнений, кроме того эти вирусы поражают молодое трудоспособное население.

Респираторно-синцитиальная вирусная инфекция (РСВ) – одна из главных причин тяжелых заболеваний верхних и нижних дыхательных путей у новорожденных и детей раннего возраста. Ежегодно в мире в результате заболеваний нижних дыхательных путей, связанных с РСВ, умирает несколько миллионов детей младше 5 лет. Кроме того, РСВ инфекция, перенесенная в детском возрасте, приводит к развитию гиперчувствительности дыхательных путей у детей и к развитию бронхиальной астмы в дальнейшей жизни (Johnston S.L., 2005).

Таким образом, цель настоящей работы и основные задачи исследования продиктованы повсеместной распространённостью вирусных инфекций, а также тяжестью заболеваний, ассоциированных с различными вирусами и очевидной необходимостью поиска принципиально новых подходов к конструированию лечебно-профилактических средств для профилактики и лечения вирус-ассоциированных заболеваний.

Цель исследования: разработать новые подходы для создания средств профилактики и лечения вирус-ассоциированных заболеваний.

Задачи исследования:

  1. Получение дрожжевых репликативных плазмид, предназначенных для экспрессии белка L1 папилломавируса человека серотипов 16 и 18 в клетках дрожжей Saccharomyces cerevisiae. Отработка протоколов выделения вирусоподобных частиц (ВПЧ)  в количестве, необходимом для исследования. Тестирование иммуногенности рекомбинантных белков L1 ВПЧ in vivo на мышах.
  2. Идентификация консервативных иммунодоминантных эпитопов белков HPV L1 и E7 серотипов вируса 16, 18 и 31.Синтез и очистка пептидов, имитирующих иммунодоминантные эпитопы белков L1 и E7.Тестирование иммуногенности синтезированных пептидов в опытах на мышах.
  3. Конъюгирование и комбинирование полученных пептидов с иммуномодуляторами. Определение уровня иммуногенности созданных комбинаций in vivo.
  4. Изучение вирус-индуцированной экспрессии и продукции интерферонов первого и третьего типа in vitro. Выявление основного типа интерферонов, продуцируемых эпителиальными клетками при ОРВИ.
  5. Изучение генома респираторного синцитиального вируса.
  6. Дизайн siRNA против мРНК белка Р респираторного синцитиального вируса.
  7. Оценка антивирусной активности siRNA против мРНК белка Р респираторно-синцитиального вируса in vitro в культуре клеток.
  8. Оценка антивирусной активности siRNA против мРНК белка Р респираторно-синцитиального вируса in vivo на мышах.
  9. Выявление наиболее эффективных siRNA против мРНК белка Р респираторно-синцитиального вируса.

Научная новизна

Впервые в мире показано, что интерфероны третьего типа являются основными интерферонами, продуцируемыми клетками респираторного эпителия при ОРВИ.

Впервые в Российской Федерации созданы дрожжевые штаммы-продуценты, способные экспрессировать рекомбинантные капсидные белки L1 HPV вирусных серотипов 16, 18 в виде ВПЧ. Впервые разработана технология выделения ВПЧ из дрожжевых экстрактов. Были получены пептиды длиной от 9 до 35 аминокислот, представляющие собой фрагменты трансформирующего белка E7 HPV cеротипов 16 и 31 (Т-эпитопы, как основа терапевтических композиций), а также фрагменты L1 HPV16 (иммунодоминантные В- и Т-эпитопы). Полученные данные свидетельствуют, что рекомбинантные ВПЧ  индуцируют высокий уровень гуморального иммунного ответа. Свободные рекомбинантные ВПЧ и пептиды из белка Е7 в сочетании с иммуномодуляторами активировали клеточный иммунный ответ. Таким образом, впервые в Российской Федерации получены препараты имеющий профилактический и терапевтический потенциал в отношении HPV- инфекции.

Впервые в Российской Федерации экспериментально изучена возможность использования  средств на основе siRNA против вирусов in vitro и in vivo. 

Проведен дизайн siRNA против мРНК белка Р респираторно-синцитиального вируса, были сконструированы 6 уникальных экспериментальных образцов siRNA, получивших рабочие названия si01, si03, si05, si07, si09 и si11, нацеленных к различным участкам мРНК белка Р РСВ в пределах открытой рамки считывания.

На модели РС-инфекции в культуре клеток МА104 была проведена оценка противовирусного действия экспериментальных образцов siRNA. Подобранные специфические siRNA эффективно подавляли репродукцию респираторно-синцитиального вируса в культуре клеток.

Впервые в Российской Федерации экспериментальные образцы siRNA проявили противовирусную активность in vivo. Причём полученные в эксперименте на мышах данные подтвердили данные, полученные в культуре клеток.

Таким образом, впервые в Российской Федерации проведенные исследования in vitro и in vivo продемонстрировали противовирусную активность испытанных экспериментальных образцов препаратов по снижению репликации  респираторно-синцитиального вируса, одного из главных этиологических факторов вирус-индуцированной бронхиальной астмы, что делает возможным создание специфических противовирусных средств на основе механизма интерефернции РНК.

Практическая значимость

На сегодняшний день в мире не существует лекарственных средств для эффективной элиминации вирусов из организма человека и лечения социально-значимых вирус-ассоциированных заболеваний. Для решения этой проблемы в данной работе были показаны различные подходы к созданию лечебно-профилактических противовирусных средств.

Разработка предложенных в работе антивирусных препаратов имеет стратегическое значение для биобезопасности Российской Федерации. Так, в эпоху биотерроризма респираторные вирусы, ввиду своей способности быстро инфицировать большое количество людей и вызывать смертельно опасные заболевания, несут в себе огромную опасность для населения страны. Наличие высокоспецифичных и высокоэффективных противовирусных средств, основанных на миРНК, позволит оптимизировать профилактику и лечение состояний, ассоциированных с РСВ.

       Кроме того, крайне перспективным представляется экономический эффект от коммерциализации противовирусных препаратов. По данным журнала “Forbes” в США продажи антивирусных препаратов за 2007 год составили 10,6 миллиарда долларов. По прогнозам экспертов из консалтингового агентства Business Communications  рост продаж антивирусных препаратов  в ближайшие 3 года должен составить около 40%.

       По данным ЦМИ Фармэксперт за 2006 год  в России объём продаж системных противовирусных препаратов составил 5,37% (4-ое место) от общего объёма продаж лекарственных средств, а по темпам прироста продаж по сравнению с 2005 годом – 62% занял первое место со значительным отрывом от группы препаратов сердечной терапии.

На сегодняшний день существует потребность в создании эффективной противовирусной терапии для предотвращения и лечения состояний и заболеваний, связанных с вирусной инфекцией. Возможность использования предложенных методик в качестве эффективных специфических противовирусных средств, безусловно, должна реализоваться в разработке надежных, безопасных и не дорогих противовирусных терапевтических препаратов.

Положения, выносимые на защиту:

1. Отработаны протоколы выделения ВПЧ. Препараты ВПЧ из белков L1 HPV cеротипов 16 и 18 наработаны в количестве, необходимом для анализа. Анализ препаратов методами визуализации в геле, иммуноферментным методом при помощи специфических антител, а также методом электронной микроскопии позволил сделать вывод о соответствии полученных частиц искомым вирусоподобным частицам.

2. Полученные препараты ВПЧ из белков L1 HPV cсеротипов 16 и 18 являются высокоиммуногенными антигенами.

3. Выбранные участки аминокислотных последовательностей внутреннего белка Е7 ВПЧ 16 и 31 соответствуют Т-клеточным эпитопам ВПЧ. Синтезированные пептиды обладают специфическими иммуногенными свойствами при использовании с иммуностимулирующими препаратами.

4. Комбинированное использование полученных вирусоподобных частиц, состоящих из белка L1 с пептидами, имитирующими Т-клеточные эпитопы белка Е7, перспективно в контексте создания лечебно-профилактической вакцины против вируса папилломы человека.

5. ИФН- служит основным фактором противовирусной защиты респираторного эпителия.

6. Белок Р является успешной мишенью для эффективного подавления РСВ при помощи siRNA. siRNA к мРНК белка Р респираторно-синцитиального вируса эффективно снижает репликацию РСВ in vitro и in vivo.

7. siRNA может использоваться в качестве специфического противовирусного средства, не влияющего на нормально протекающие процессы в клетке.

8. siRNA может применяться в качестве противовирусного средства без специальных средств доставки в чистом виде при эндотрахеальном и ингаляционном введении, что может использоваться при создании лечебно-профилактических средств против респираторных вирусов.

9. Описана возможность создания эффективного лекарственного средства против РСВ, одного из основных этиологических факторов вирус-индуцированной бронхиальной астмы, с использованием механизма интерференции РНК.

Апробация работы

Результаты исследования докладывались: на XXII (Париж, Франция 7-11 июня 2003), XXVI (Гётеборг, Швеция, 9-13 июня 2007г.), XXVII (Барселона, Испания, 7-11 июня 2008г.) конгрессах Европейской Академии Аллергологии и Клинической Иммунологии; на XVIII Конгрессе Всемирной Аллергологической Организации (Ванкувер, Канада, 7-12 сентября 2003); на VIII конгрессе Российской ассоциации аллергологов и клинических иммунологов (РААКИ) «Современные проблемы аллергологии, иммунологии и иммунофармакологии» (Москва, Россия, 27-29 июня 2007г.); на 1-м на 2-м Международных конгрессах «Иммунитет и болезни: От теории к терапии» (Москва, Россия, 3-7 октября 2005г.; Москва, Россия, 10-14 сентября 2007г.); на конгрессах Американской Академии Аллергологии, Астмы и Иммунологии (Сан Диего, США, 23-27 февраля 2007 г. и Филадельфия, США, 14-18 марта 2008 г.); на ежегодном съезде Американского Колледжа Аллергологии, Астмы и Иммунологии (Даллас, США, 8-14 ноября 2007 г.).

Часть вошедших в диссертацию материалов представлена в работе, которой  присуждена премия Правительства Российской Федерации за 2007 год в области науки и техники.

Основные результаты диссертационной работы отражены в 33 публикациях, в ведущих рецензируемых научных журналах, в том числе в 21 отечественном журнале и 12 зарубежных изданиях.

Объем и структура диссертации. Диссертационная работа построена по традиционному плану, изложена на 220 страницах машинописного текста, состоит из введения, обзора литературы, разделов, описывающих материалы и методы исследований, результаты, обсуждения полученных результатов и выводов. Диссертация иллюстрирована 16 таблицами, 39 рисунками, включая фотографии. Список использованной литературы включает 250 источников, из них 20 отечественных и 230 зарубежных.

Материалы и методы исследований

Рекомбинантные ВПЧ HPV16 и 18. С целью клонирования генов белков L1 HPV проводили дизайн праймеров для амплификации целевых генов. На основе синтезированных праймеров и клинического материала (от HPV-инфицированных пациентов) синтезировали фрагменты ДНК размером около 1500 нуклеотидов, что соответствует размерам их генов,  и затем эти фрагменты клонировали в вектор pUC19. Вектор pPDX2, предназначенный для  экспрессии белка L1 в клетках дрожжей, конструировали на основе плазмиды pPDX1, после чего фрагменты, содержащие гены, кодирующие белок L1, переносили в этот вектор. В итоге получали плазмидные конструкции, содержащие соответствующие L1-гены (плазмиды pPDX2-L1-16, pPDX2-L1-18).

Трансформация дрожжей, продуцирование и выделение белков L1 в виде ВПЧ. В качестве дрожжевого штамма-продуцента использовали штамм Y618 дрожжей Saccharomyces cerevisiae, который трансформировали плазмидами pPDX2-L1-16/18. Для наработки ВПЧ дрожжевые клетки культивировали в питательной среде, затем наросшую клеточную массу отделяли центрифугированием и добавляли в нее протеазные ингибиторы. Клетки лизировали, лизат осветляли центрифугированием (5000g) и центрифугировали в градиенте сахарозы (100000g). Фракцию с частицами ВПЧ выделяли с границы раздела фаз 45/70%-растворов сахарозы и подвергали ультрафильтрации на мембране 10 кДа, осветляли центрифугированием и фильтровали через мембрану 100 кДа. Время достижения максимальной концентрации ВПЧ в дрожжевой клетке (40-80 часов) зависело от серотипа вируса и состава питательной среды. Для препаративного выделения ВПЧ клетки-продуценты выращивали в питательной среде со специфичным для каждого серотипа источником углерода.

Подтверждение структуры рекомбинантных ВПЧ. Полученные препараты L1 ВПЧ анализировали с помощью денатурирующего электрофореза в полиакриламидном геле (SDS-PAGE), твердофазным иммуноферментным анализом (ИФА) и иммуноблоте, используя специфические для L1 ВПЧ моноклональные антитела (МКА), полученные от US Biological, вируснейтрализующие МКА, любезно предоставленные проф. Neil. D. Christensen (Pennsylvania State University College of Medicine, Hershey, Pennsylvania, USA) и поликлональные антимышиные антитела к синтетическим пептидам из белков L1 HPV, соответствующие доминантным В-эпитопам. Морфологические доказательства правильности сборки белков L1 в структуру ВПЧ получали с помощью электронной микроскопии на приборе JEOL-100СХ при 80 кВ и увеличении 55000 и 350000; образцы контрастировали уранилацетатом. Микрофотографии приведены на рис. 1.

Пептиды. Синтез пептидов проводили стандартным твердофазным методом, используя Fmoc-химию. В синтезе использовали стартовые Fmoc-аминокислоты на полимере Wang фирмы NovaBiochem. Боковые карбоксильные и гидроксильные группы аминокислот защищались трет-бутильной группой (t-Bu), аминогруппа лизина – Boc, SH-группа цистеина – Acm и гуанидиновая функция аргинина – Mtr. Очистку сырых пептидов проводили гель-хроматографией на смоле Toypearl HW40 и ВЭЖХ (Zorbax ODS 0.94 x 25 cm). Анализ гомогенности пептидов проводили аналитической ВЭЖХ (Vydac 218ТР54, 4.6 x 250 mm), структуру подтверждали масс-спектрометрией (MALDI).

Конъюгаты пептидов c KLH.  6-10 мг пептида растворяли в 1000 мкл 0.1 М фосфатного буфера (ФБ, рН 9.0) и раствор смешивали с 800 мкл раствора 18 мг KLH (Sigma, H8283) в ФБ. Смесь перемешивали 30 мин. и охлаждали до 4оС. Добавляли 1.5 мкл охлажденного до 4оС раствора глутарового альдегида (Serva) в 250 мкл ФБ и реакционную смесь перемешивали 1 час и оставляли на 22 часа при 4 оС. Затем добавляли охлажденный свежеполученный раствор 10 мг NaBH4 (Sigma) в 400 мкл дист. воды и оставляли 1 час при комн. т-ре. Все содержимое переносили в диализную трубку Servapore и проводили исчерпывающий диализ против дист. воды. Полученный диализат замораживали, лиофилизовывали и затем конъюгат очищали хроматографией на колонке с сефадексом G-25.

Конъюгаты пептидов с полиоксидонием (ПО). Этиленпиперазиний-бромидные звенья ПО превращали в реактивную, азидную, форму, и затем азидное производное вводили в реакцию с пептидами. Степень конденсации контролировали по убыли свободного пептида из реакционной смеси путем ВЭЖХ. Конъюгаты подвергали диализу и полученный диализат лиофильно высушивали. Содержание пептида в конъюгате определяли аминокислотным анализом (Biotronik LC5000) и спектрофотометрически по приросту поглощения при 275 нм. Исходное содержание карбоксильных групп в ПО ~36 остатков на одну цепь полимера (мол. масса ~50 kDa), что соответствует ~0.7 ммоля/г полимера. Продукты конденсации  пептидов с ПО представляли собой бесцветные или слегка окрашенные порошки.

Иммунизация и ИФА. Мышей (самцы) линии CBAхBALB/c (F1) иммунизировали внутрибрюшинно 3-4 раза с интервалом в 2 недели. В каждой группе животных (5 в группе) использовали один из иммуногенов в дозе 50 мкг/мышь. Забор крови осуществляли через 2-недельные интервалы из ретроорбитального синуса каждой мыши контрольной и опытной групп. Полученные из крови образцы сывороток анализировали стандартным вариантом твердофазного ИФА, используя конъюгат анти-IgG мыши с полимеризованой пероксидазой (Amersham) и высокочувствительный субстрат ТМВ (Sigma) согласно инструкции производителя. Величину фонового поглощения (Cut off) оценивали как среднее значение величины оптической плотности для нормальных сывороток (n = 5) + 3 SD. Сыворотки титровали, используя двоичное разведение, начиная с 1:50. Их титр определяли как конечное разведение, при котором оптическая плотность (OD) превосходила OD нормальной сыворотки в 2 раза.

Сепарация популяций Т-клеток. Для анализа цитотоксической активности Т-клетки, выделенные из спленоцитов иммунных и контрольных мышей, обогащали популяцией CD8+-клеток путем удаления CD4+-клеток с помощью магнитных шариков Dynalbeads Mouse CD4 (L3T4) фирмы Dynal (Lake Success, USA), покрытых специфическими антителами, согласно протоколу производителя. Эффективность удаления CD4+-популяции, которую оценивали проточной цитофлуорометрией с FITC-мечеными анти-CD4-антителами, достигала 98%.

Анализ Т-клеточной активности методом ELISPOT. Спленоциты (суммарный пул Т-клеток) или CD8+-обогащенную фракцию клеток помещали в 96 луночные планшеты (~400 000 клеток/лунку), на дне которых были сорбированы антитела против IFN- мыши, и инкубировали их в питательной среде вместе с пептидами (10, 5, 2.5 мкг/лунку), имитирующими Т-эпитопы, в течение 18 часов при 37 в 5% атмосфере СО2 . По окончании инкубации клетки удаляли и вносили вторые антитела, против IFN-, меченные биотином, после отмывки вносили стрептовидин-пероксидазу хрена, инкубировали, отмывали и вносили субстрат. Подсчет окрашенных клеток проводили на анализаторе Eli.Scan (AELVIS), все пробы ставились в трех параллелях.

       Культивирование человеческих бронхоэпителиальных клеткок и респираторных вирусов

       Человеческие бронхоэпителиальные клетки были приобретены в Cambrex, США. Клетки были помещены в среду BEBM (Cambrex, США), содержащую 2мл BPE, 0.5мл инсулина, HC 0.5 мл, GA-1000 0,5 мл, 0.5 мл ретиноевой кислоты, 0.5 мл трансферрина, 0.5 мл трийодтрионина, 0.5 мл эпинефрина, 0.5 мл hEGF (Cambrex, США). После первого пассажа клетки были посеяны на 12-луночный планшет и культивировались до 80% конфлюентности (Bucchieri  F, 2002) , после чего были инфицированы РВ 16, 1В и вирусом гриппа.

       Культура человеческих бронхоэпителиальных клеток BEAS-2B культивировалась в среде RPMI-1640 c добавлением 10% бычьей сыворотки (Invitrogen). РВ16 и 1В были выращены на клетках HeLa (Papi A, 1999). Вирусы были раститрованы на клетках HeLa для определения TCID50/ml (Johnston SL, 1995). Риновирусы были идентифицированы в реакции нейтрализации с использованием серотип-специфических антител. Инактивация вирусов ультрафиолетом была проведена по ранее описанной методике (Johnston SL, 1998). Вирус гриппа А Victoria 75/3 был культивирован на клетках MDCK. После достижения 80% конфлюентности клетки были промыты два раза стерильным PBS, а затем культура клеток была помещена в среду ЕМЕМ (сыворотка в среде отсутствовала). 0,5мл стокового вируса гриппа было добавлено в среду, содержащую клетки, которая затем была помещена в СО2 –инкубатор при 37С на 1 час. Клетки были промыты для удаления не прикрепившихся вирусных частиц, ресуспензированы в бессывороточной среде и инкубировались при 37C 5% CO2 48 часов. Спустя два дня после инфицирования, супернатанты были отобраны, разаликвотированы и помещены на хранение при -80С.

       Клетки линии BEAS-2B были помещены в 12-луночные планшеты и инкубировались при 37C 5% CO2 24 часа. Затем клеточная среда была заменена средой RPMI с 2% содержанием сыворотки, и клетки инкубировались ещё 24 часа при 37C 5% CO2.  Клетки были инфицированы риновирусами, после чего инкубировались один час при комнатной температуре на шейкере. Спустя час среда была заменена средой RPMI с 2% содержанием сыворотки. Клеточные супернатанты и лизаты были собраны спустя 0, 4, 8 и 24 часа спустя инфицирования и помещены на хранение при -80С.





Выделение мононуклеарных клеток и инфицирование РВ 16

       Мононуклеарные клетки были выделены из цельной крови методом градиентного центрифугирования (Sigma-Aldrich, Великобритания). Затем клетки в концентрации 4*106 /2мл были инфицированы РВ 16. Спустя час клетки были отмыты и помещены в культуральную среду. Клеточные супернатанты и лизаты были собраны спустя 4, 8 и 24 часа спустя инфицирования и помещены на хранение при -80С.

Выделение РНК, обратная транскрипция и Taqman RT-ПЦР

       РНК была выделена из клеток методом Rneasy в соответствии с инструкцией производителя. Процесс выделения РНК сопровождался дополнительной обработкой образца ДНКазами (Qiagen) для элиминации ДНК. кДНК была синтезирована при помощи набора Omniscript в соответствии с инструкцией производителя (Qiagen).

       Праймеры для Taqman RT-ПЦР были приобретены в Invitrogen, зонды в Qiagen. Количественная оценка исследуемых мРНК производилась в соответствие с 18s рРНК. Анализ экспрессии мРНК производился на оборудовании ABI7000 Automated TaqMan (Applied Biosystems). Цикл амплификации включал в себя 50C 2 минуты, 94C 10 минут и 40 циклов - 94C по 15 секунд, 60C по 15 секунд.

Оценки продукции интерферонов и RANTES

Продукция белка была измерена в супернатантах инфицированных и неинфицированных клеток методом ИФА в соответствии с инструкцией производителя (Amersham Biosciences для ИФН-, FUJIREBIO INC для ИФН-, и Biosource для RANTES). ИФА ИФН- был проведён в соответствии с опубликованными материалами (Contoli M, 2006).

Экспериментальные животные

Для получения модели инфекции использовали мышей линии BALB/C обоих полов весом 18-20 грамм. Животные поступали из питомника ГУ НИИ вакцин и сывороток им. И.И. Мечникова РАМН, Москва. Работа и уход за животными проводились согласно нормам и правилам обращения с лабораторными животными в соответствии с «Положением об этическом отношении к лабораторным животным», согласно приказу директора ГНЦ Институт иммунологии от 07.07.2003 и приказа МЗ РФ от 19.06.2003 №267 «Правила лабораторной практики в Российской Федерации».

Культивирование клеток и вируса

РСВ штамм Long размножали в культуре клеток МА104, которые культивировали на питательной среде, состоящей из двух частей МЕМ и одной части DMEM с добавлением 4% фетальной сыворотки коров, L-глутамина  (300 мкг/мл) и гентамицина (50 мкг/мл) в инкубаторе с 5% CO2  при 37C. За 24 часа до заражения вирусом клетки пересевали на культуральные флаконы 162 см2, чтобы к моменту заражения они образовали монослой с 50% конфлюентностью. Клетки дважды промывали средой без сыворотки и заражали 1 мл вируса, содержащего 2*104 ТЦД50/мл. После 2 часов адсорбции вируса при 37C, при периодическом покачивании флаконов, добавляли 60 мл поддерживающей среды. Поддерживающая среда отличается от питательной отсутствием фетальной сыворотки и повышенным содержанием L-глутамина  (600 мкг/мл). Через 48 часов после заражения, наблюдали характерное для РСВ ЦПД в виде образования множества синцитиев, при этом основная часть монослоя оставалась прикрепленной.

Трансфекция клеток МА104 siRNA и заражение РСВ

За 24 часа до трансфекции клетки МА104 пересевали на 12-ти луночные планшеты с такой плотностью, чтобы к моменту трансфекции они образовали монослой с 50% конфлюентностью. Перед трансфекцией производили смену среды на бессывороточную Opti-MEM I. Трансфекцию siRNA производили с использованием реагента для трансфекции Lipofectamine2000 по рекомендованной производителем методике. Спустя 4 часа после трансфекции клетки заражали РСВ в дозе 103 ТЦД50/лунку. Через 4 часа после заражения проводили вторую трансфекцию siRNA.

Через 48, 72 и 96 часов после инфицирования из лунок отбирали культуральную жидкость для титрования по ЦПД и анализа методом количественной ПЦР.

Из лунок с клетками, зараженными РСВ и обработанными специфическими и неспецифическими siRNA, через 48, 72 и 92 ч после инфицирования переносили по 200 мкл культуральной жидкости в пробирки и осветляли низкоскоростным  центрифугированием при 2000 об/мин в течение 5 мин. Осветление культуральной жидкости при подготовке материала для ПЦР делали для того, чтобы оценить количество РНК «отпочковавшихся» вирионов, т.е. полностью завершивших цикл репродукции. Часть надосадочной жидкости сразу использовали для титрования вируса, другую часть хранили при -70С до исследования методом ПЦР. Таким образом, наряду с титрованием вируса по ЦПД, ПЦР выступает в роли метода дополнительного контроля уровня вирусной репродукции.

Контроль трансфекции siRNA

Контроль трансфекции производили использованием флюоресцентно-меченной siRNA к мРНК структурного клеточного белка ламина – siGLO Lamin A/C. Ламин предствляет собой белок, относящийся к филаментам, и являющийся одним из наиболее распространенных белков ядерной мембраны. Этот белок экспрессируется в большинстве клеток млекопитающих, причем сайленсинг его мРНК не влияет на жизнеспособность клетки. Трансфекция siGLO Lamin A/C позволяет оценивать эффективность проникновения в клетку siRNA по флюоресценциии клеточных ядер, интенсивность которой контролировалась под флюоресцентным микроскопом.

Титрование вируса в культуральной жидкости по ЦПД определением конечной точки

Титрование вируса производили путем пятикратных разведений вирусного материала в 96-луночных планшетах с подготовленным монослоем клеток МА104. Титр РСВ определяли на 8 день по последнему разведению, в котором наблюдалось развитие ЦПД с образованием специфических синцитиев. Титр вируса рассчитывали по методу Рида и Менча и выражали в ТЦД50/мл, т.е. в количестве 50% тканевых цитопатических доз вируса, содержащихся в 1 мл.

Определение количества вирусной РНК в культуральной жидкости методом обратной транскрипции и ПЦР в реальном времени

В работе были использованы праймеры, направленные к F-гену, подобранные на основании анализа нуклеотидной последовательности генома РСВ штамм Long.

Прямой праймер – GTGTTGGATCTGCAATCG.

Обратный праймер – CTGTTGTTCTTTTGTTGGAACTC.

Размер  ампликона – 258 пар оснований.

Суммарную нуклеиновую кислоту выделяли из 100 мкл образца, используя коммерческий набор реагентов «ИзоГен». кДНК получали в 30 мкл реакционной смеси, содержащей буфер для ОТ, 0,5 мМ каждого дНТФ, 12,5 пкмоль прямого праймера, 5 ед. ингибитора рибонуклеаз, 50 ед. ревертазы вируса лейкоза Молони, 8 мкл РНК, при 37С в течение 30 минут. Фермент инактивировали прогреванием при 95С в течение 5 минут.

Далее, образцы  анализировали методом  ПЦР с флюоресцентной детекцией в режиме реального времени (РВ) в присутствии интеркалирующего красителя SYBR Green-1. Амплификацию проводили в 25 мкл реакционной смеси, состоящей из реактивов набора для проведения ПЦР РВ “Синтол”, и 12,5  пмоль каждого праймера в термоциклере АНК-16.

Программа ПЦР:

95С - 120 сек - 1 цикл;

55С - 50 сек, 95С - 20 сек - 45 циклов.

Для построения калибровочной кривой был использован калибратор – ПЦР-продукт, вырезанный из геля, очищенный, с известной концентрацией. Расчет пороговых циклов, построение калибровочных кривых, расчет числа копий кДНК проводили при помощи программного обеспечения к амплификатору АНК-16.

Специфичность ПЦР контролировали при помощи процедуры “плавления” продуктов реакции и методом электрофореза в 2% агарозном геле, содержащем бромистый этидий. Результаты выявляли и документировали в ультрафиолетовом свете (312 нм) при помощи гель-документирующей системы «Gel Imager».

Экспериментальная модель инфекции РСВ на мышах

Перед началом эксперимента животных распределили по группам и взвесили. В каждую группу входило 6 мышей – 4 самки и 2 самца. Всего было сформировано 6 групп: 1 группе вводили смесь РСВ и si01, 2 группе – РСВ и si03, 3 группе – РСВ и si05, 4 – РСВ и siHRV, 5 – смесь РСВ и фосфатно-солевого буфера, 6 – фосфатный солевой буфер. При учете результатов опыта 4 группа считалась контрольной.

Животные 1, 2, 3, 4 групп получили 60 мкл siRNA (1 мкг/мкл) и 40 мкл вируса с титром 2*106ТЦД50/мл, 5 группе вводили вирус, смешанный с фосфатно-солевым буфером в тех же пропорциях. Введение РСВ и siRNA осуществляли эндотрахеально при помощи катетера. Действия, связанные с эндотрахеальным введением вируса и препаратов siRNA, а также вынужденный убой мышей, сопровождались внутрибрюшинной инъекцией наркотизирующего средства диазепам в дозе 15 мг/кг.

Спустя 6 дней после заражения животных забивали и извлекали легкие вместе с трахеей. Перед убоем мышей взвешивали.

Титрование вируса в смывах из легких мышей                                Легкие мышей помещали на стерильную чашку Петри и при помощи инсулинового шприца многократно промывали 1 мл поддерживающей среды. Полученный смыв осветляли центрифугированием (5 минут, 5000 об/мин) при 4C. Титрование вируса в полученных смывах проводили путем последовательных трехкратных разведений вирусного материала в 96-луночных планшетах с подготовленным монослоем клеток. Титр РСВ учитывали на 10 день после заражения по последнему разведению, в котором наблюдалось характерное ЦПД.

Статистический анализ

Полученные данные представляли в виде среднего значения ± стандартная ошибка среднего значения. Оценивали достоверность отличия титра вируса и количества вирусной РНК в культуральной жидкости в лунках, обработанных исследуемыми siRNA, по сравнению с обработанными контрольной siRNA (siHRV) по t-критерию Стьюдента, считая различие достоверным при P<0,001. Статистическую значимость различий в количестве вирусной РНК в разных группах мышей оценивали в соответствии с критерием t Стьюдента, различие считали достоверным при P<0,05.

Результаты исследования и их обсуждение

Получение рекомбинантных ВПЧ серотипов 16 и 18. Требуемые последовательности генов длиной 1511 п.н.  (HPV16) и 1521 п.н. (HPV18) были получены с помощью ПЦР на основе клинических проб HPV-инфицированных лиц. В амплификации генов каждого серотипа были задействованы  две различные пробы с данным серотипом, реакцию повторяли четыре раза.

Фрагменты, полученные в результате ПЦР, были очищены и клонированы в вектор pUC19, взятый из коллекции лаборатории биотехнологии дрожжей ГОСНИИГенетика.

Вектор pPDX2, предназначенный для  экспрессии белка L1 в клетках дрожжей, был сконструирован на основе плазмид pPDX1, и pUCGALatgXhoI. При этом первую плазмиду использовали в качестве вектора, а из второй плазмиды получали фрагмент, несущий промотор GAL1-10. Полученная конструкция, таким образом, несет фрагмент последовательности 2-микронной плазмиды дрожжей, позволяющий ей реплицироваться в клетках дрожжей, ген URA3, являющийся селективным маркером при трансформации клеток дрожжей, промотор гена GAL1-10, ген bla, являющийся селективным маркером при трансформации клеток E. coli и точку начала репликации для бактериальных клеток. Фрагменты, содержащие гены, кодирующие белки L1, были перенесены в вектор pPDX2. В качестве дрожжевого штамма-продуцента был выбран штамм Y618 Saccharomyces cerevisiae. Была произведена трансформация этого штамма плазмидами pPDX2-L1-16 и pPDX2-L1-18, а также вектором pPDX2. Последняя трансформация была сделана с целью получения отрицательного контроля.

Экспрессию белков L1 оценивали в трансформантах штамма по данным электрофореза. Белковые пробы были отобраны после первого центрифугирования в градиенте сахарозы и нанесены на полиакриламидный гель. Полоса около 100 кДа соответствует по размеру эндогенным Ti-частицам дрожжей. Белок L1 в виде ВПЧ выделяли из всех трансформантов штамма Y618. В рамках оптимизации протоколов продуцирования и выделения ВПЧ из дрожжевых клеток была выбрана наилучшая среда (варьирование источника углерода), длительность культивирования, а также условия разделения частиц в градиенте сахарозы.

По этим данным для штамма 618/pPDX2-L1-18 лучшей следует признать среду с 3% глюкозы, 3% глицерина (и добавлением 2% галактозы к концу логарифмической фазы), а для штамма 618/pPDX2-L1-16 лучшей является среда с 0,5%глюкозы, 3% глицерина и 1,5% этанола (и добавлением 2% галактозы к концу логарифмической фазы). Оптимальное время роста – 67 часов.

Пептиды и антипептидные антитела. Используя данные третичной структуры  (софт от SWISS-MODEL protein modeling server/Swiss-Pdb Viewer 3.7,  предсказаны участки, формирующие вероятные доминантные В- и Т-эпитопы белков L1 (типы 16 и18) и белка Е7 (тип 31) (таблица 1). Короткие пептиды длиной 9-14 аминокислот, имитирующие Т-эпитопы, предназначались для анализа Т-клеточной активности методом ELISPOT, длинные пептиды – для индукции В- и Т-клеточного ответа.

Таблица 1. Синтезированные пептиды белков HPV

Последовательность

Нумерация аминокислот

Код пептида

L1 HPV16

C-QPLGVGISGHPLLNKLDDTE-C

C(Acm)-LNKLDDTENASAYAANAGVDNRE-C(Acm)

C-LNKLDDTENASAYAANAGVDNRE-C

AGVDNRECI

FNRAGTVGENVPDDLYIKGSGS

DWNFGLQPPPGGTL

QPPGGTLEDTYRFVTQAIAC

97-116-бисСys

109-132

109-132

165-173

247-268

387-400

393-413

NC-724

NC-723-С/Acm NC-723

NC-732

C-12

C-13

C-14

L1 HPV18

NVFPIFLQM

54-62

NC-731

  E7 HPV16

GQAEPDRAHYNIVTFCCK

43-60

NC-725

E7 HPV31

VLDLQPEATD

GQAEPDTSNYNIVTFCCQ

GQAEPDTSNYNIVTFCCQCKSTLRLCVQSTQVDIR

DTSNYNIVTF

TSNYNIVTF

ELLMGSFGIVC(Acm)PN(A)

ELLMGSFGIVCPN(A)

12-21

43-60

43-77

48-57

49-57

81-93A

81-93A

NC-727

P-1

P-236

NC-730

NC-729

NC-728

NC-728-F

Для повышения иммуногенности пептидов с целью получения высокотитражных сывороток, пригодных для ИФА и иммуноблота, были синтезированы конъюгаты пептидов с полиоксидонием (ПО) и KLH.

Одной из целей работы было сравнение эффективности различных форм подачи пептидных иммуногенов. Иммунизацию проводили: 1) свободными пептидами, эмульгироваными в ПАФ (пептид + ПАФ); 2) конъюгатами пептида с ПО (пептид-ПО); 3) конъюгатами пептида с KLH с ПАФ (пептид-KLH + ПАФ); 4) смесью пептида с адъювантом полимурамилом (пептид + ПМ) (см. таблицы 2, 3). Продукцию антител класса IgG анализировали твердофазным ИФА. В таблице 2 приведены титры сывороточных антител после двукратной иммунизации мышей F1 (интервал 2 недели) различной формами подачи пептидов, фрагментов L1 HPV16. Как видно из таблицы 2 свободные пептиды, эмульгированные в адъюванте Фрейнда (за исключением пептида С-14) не обладали иммуногенностью (титр 50, как для неиммунной сыворотки). Ковалентные конъюгаты пептидов с полиоксидонием имели более высокую иммуногенность. Так, свободный пептид C-12 не давал продукции антител,  даже в присутствии ПАФ, в то время как его ПО-конъюгат (без ПАФ) после второй иммунизации индуцировал антитела с титром 1:800. Пептиды С-13 и NC-724 не давали продукцию антител в обоих вариантах, пептиды NC-723 имел умеренную активность в присутствии ПАФ. Интересно, что пептид С-14 обладал высокой иммуногенностью во всех формах подачи. Поливалентные конъюгаты пептидов с ПО были неиммуногенны (табл. 3).

Дальнейшие эксперименты показали, что конъюгаты тех же пептидов с KLH, индуцировали наибольшие титры антител (табл. 3). Анализ прямолинейных участков на кривой титрования позволяет выбирать оптимальные рабочие разведения сывороток для дальнейшего их использования в иммуноблоте и ИФА при оценке экспрессии и качества рекомбинантных ВПЧ.

Таблица 2. Титры антител при иммунизации мышей при различной форме подачи иммуногена.

Иммуноген

Антиген на подложке

С-12

С-13

С-14

NC-723

NC-724

С-12 + ПАФ

50

С-12-ПО

800

С-12-KLH +ПАФ

≥6400

С-13 + ПАФ

≥50

С-13-ПО

50

C-13-KLH + ПАФ

≥102400

С-14 + ПАФ

>>6400

С-14-ПО

>>6400

NC-723 + ПАФ

≥800

NC-723-ПО 

≥100

NC-723-KLH + ПАФ

51200

NC-724 + ПАФ

100

NC-724-ПО

50

NC-724-KLH + ПАФ

1600

N

50

50

50

50

50

N – неиммунная сыворотока (n=4)

Таблица 3. Иммуногенность ди- и тетравалентных конъюгатов ПО.

Иммуноген

Антиген на планшете

Титр сывороток

ПО/С-12/P-236

C-12

P-236

50100

50100

ПО/NC-723/P-236

NC-723

P-236

50100

50100

ПО/NC-725/P-236

NC-725;

P-236

50100

50100

ПО/NC-725/NC-727/NC-728/P-236

NC-725;

NC-727

NC-728

P-236

50100

50100

50100

50100

Адъювант полимурамил показал высокую эффективность при совместной подаче с пептидами, как с одиночными пептидами, так и смесью (тетравалентный иммуноген) (таблица 4). Отсутствие антительной продукции у пептидов NC-727 и NC-728F может быть связано с тем, что они моделируют Т-эпитопы.

Таблица 4. Титры антител в ответ на иммунизацию мышей HPV и пептидами в присутствии адъюванта полимурамила (ПМ)

Иммуноген

Антиген на планшете

NC-725

P-236

NC-727*

NC-728F*

NC-725

≤1600

NC-725 + ПМ

12800

P-236

100

P-236 + ПМ

6400

P-236 +NC-725 +NC-727 +

NC-728F + ПМ

≤6400

≤3200

200

≤200

N

≤50

≤50

≤50

≤50

* Короткие 10-14-членные пептиды, моделирующие Т-клеточные эпитопы.

       В данном случае IgG-ответ был не столь существенен, поскольку эти пептиды предназначены для анализа индукции Т-клеточного ответа.

Анализ рекомбинантных L1-белков. Дальнейший этап работы был связан с подтверждением структуры рекомбинантных L1 белков с помощью полученных наборов поликлональных (ПКА) и моноклональных (МКА) антител. Выделенные в результате центрифугирования фракции L1-белков оценивали в ИФА, используя для этого специфичные для L1 конформационно-зависимые МКА (US Biological), в том числе и вируснейтрализующие (от проф. Neil Christensen, The Milton S. Hershey Medical Center, Hershy Pennsylvania), а также линейные антипептидные поликлональные антитела, моделирующие В-эпитопы. Следует отметить, что ни один из пептидов не реагировал с имеющимися в нашем распоряжении МКА. Как видно из таблицы 5, антипептидные антитела и соответствующие МКА хорошо реагировали с полученными рекомбинантными белками. Причем наблюдалось правильное соответствие – антисыворотка к пептиду NC-723, фрагменту L1 HPV16, лучше распознавала рекомбинантный L116. Конформационно-зависимые моноклональные антитела Р3105-08 и З105-32 также очень специфично реагировали с серотипами 16 и 18.

Таблица 5. ИФА препаратов L1 HPV серотипов 16 и 18. Показаны данные оптической плотности (450 нм) образцов в повторах.

Рекомб.

Белки

Поликлональные антитела к

синтетическим пептидам

Моноклональные

антитела

С12

С13

С14

NC723

NC724

P3105-08

ВПЧ16

P3105-32

ВПЧ18

PBS (контроль)

0,093

0,089

0,112

0,079

0,157

0,049

0,083

ВПЧ16

0,729

0,326

0,591

0,941

0,768

0,926

0,182

ВПЧ16

0,738

0,322

0,566

0,868

1,035

0,981

0,176

ВПЧ18

0,704

0,405

0,510

0,436

1,044

1,121

1,052

ВПЧ18

0,683

0,392

0,543

0,402

1,348

1,211

1,015

Моноклональные вирус-нейтрализующие антитела H16 U4 S/N 9 и H18 J4 S/N реагировали как с референс-препаратами ВПЧ16 и 18 (получены от  Christensen), так и с рекомбинантными L1 16 и 18. Поскольку МКА специфичны только конформационным эпитопам ВПЧ, эти данные подтверждают правильность сборки полученных рекомбинантных белков в капсидную структуру, что является необходимым условием генерации вируснейтрализующих антител при вакцинации. Дальнейший анализ в иммуноблоте с помощью МКА P3105-08 и Р3105-32 показал присутствие специфически распознаваемой  полосы с молекулярным весом 56 кДа, соответствующим полноразмерному белку L1, а также минорной полосы, соответствующей по размеру деградированному белку L1 (примерно 45 кДа). Эндогенные Ti-частицы дрожжей (около 100 кДа) не распознавалась в иммуноблоте этими антителами (фото не приведены). 

Окончательное доказательство правильности сборки белков дала электронная микроскопия (рис. 1) Она подтвердила, что синтезированные в дрожжах белки собираются в правильные капсидные структуры, которые полностью аналогичны опубликованным ранее микрофотографиям L1 ВПЧ.

Иммуногенность рекомбинантных ВПЧ. Гибридных мышей F1 иммунизировали рекомбинантными ВПЧ 16 и 18 в присутствии или отсутствии адъювантов ПО или ПМ, тестируя гуморальный и Т-клеточный ответы. Протоколы иммунизации включали 3-х кратную иммунизацию мышей внутрибрюшинно с интервалами в 2 недели и отбором проб непосредственно перед каждой инъекцией. При тестировании антительного ответа (IgG) к ВПЧ в ИФА анализировали реактивность антител как с вводимым ВПЧ, так и с пептидом NC-723, который имитирует вируснейтрализующий эпитоп белка L1 HPV16. Оказалось, что антисыворотки к ВПЧ обладали заметной реакционной способностью с этим пептидом в отличие от других четырех пептидов из белка L1.  Хотя пептид является фрагментом L1 HPV16, он хорошо реагировал и с анти-ВПЧ18-антителами. Причина этого, по-видимому, в том, что гомология между соответствующими участками L1 этих серотипов достигает 75%, а гомология для N–концевой части фрагмента – 100% . Причем, именно эта часть фрагмента была картирована как вирус-нейтрализующий эпитоп (нейтрализующее МКА H16.S1) [6]. Интересно, что и  антитела к этому пептиду хорошо реагировали как с ВПЧ16, так и ВПЧ18 (табл. 6). Другие пептиды не показывали заметной реакции с ВПЧ-антителами.

Результаты иммунизации (рис. 2) продемонстрировали, что оба препарата ВПЧ обладают высокой иммуногенностью даже в отсутствии адъювантов, после 2-3-й иммунизации титр IgG-антител  достигал 25-50 тыс. Уровень антител зависел от кратности иммунизации. Результаты иммунизации с ПМ были такие же, как и без адъюванта. Таким образом, адъювант ПМ проявлял активность только с пептидами (см. табл. 5).

Рис. 2 Динамика иммунного ответа мышей при иммунизации препаратами ВПЧ

Анализ Т-клеточного ответа. Основная концепция терапевтической вакцины основана на индукции HPV(E7/E6)-специфических цитотоксических CD8+ (ЦТЛ) лимфоцитов для киллинга опухолевых клеток, экспрессирующих E6/E7-антигены. Хотя основную роль в профилактической вакцине играет гуморальный ответ, активация Тh-клеток важна для индукции вируснейтрализующих антител класса IgG. Общим, и часто используемым, маркером активации ЦТЛ и Th/CD4+ лимфоцитов (ТХЛ) является  секреция ими интерферона гамма (IFN-).

В данном исследовании анализировали пролиферативный ответ спленоцитов иммунных мышей после вакцинации препаратами ВПЧ16 и синтетическими пептидами. Детекцию антиген-специфических  IFN--продуцирующих клеток и подсчет их количества проводили на коммерческих наборах фирмы BD Biosciences для ELISPOT. Клетки отбирали у иммунных мышей после третьей иммунизации, а также контрольных неиммунных мышей. Их отмывали, переводили в среду с фетальной сывороткой и отделяли CD8+ - от CD4+- клеток, используя магнитные шарики с иммобилизованными анти-CD4-антителами (Dynalbeads Mouse CD4). Этот метод позволяет почти полностью отобрать нужные клетки (эффективность 98%).

Количество IFN--секретирующих клеток в лунках 96-луночной микропланшеты измеряли после 18-часовой инкубации с исследуемыми пептидами путем сканирования каждой лунки и анализа изображения (окрашенных клеток) ELISPOT-ридером Eli.Scan (Sanquin). Для активации клеток использовали пептиды с длиной цепи от 9 до 35 аминокислот при концентрациях 2.5, 5 и 10 мкг/мл, каждый опыт проводили в трех параллелях. На рис. 3 даны средние значения числа окрашенных пятен на лунку, содержащую около 400000 клеток. В качестве отрицательного контроля брали спонтанную пролиферацию (СП) клеток в отсутствии пептидов, а также пролиферацию клеток интактных мышей в присутствии пептидов. В качестве позитивного контроля брали показатели клеточной пролиферации в присутствии сильного митогена – фитогемагглютинина (ФГА).

Короткие 9-13-членные пептиды (NС-728, NC-729, NC-730 (все из E7 HPV31), NC-731 (L1 HPV18), NC-732 (L1 HPV16)), имитирующие потенциальные Т-эпитопы, были специально синтезированы для анализа Т-клеточной активности спленоцитов. Пептиды сами по себе не стимулировали пролиферацию клеток у интактных мышей за исключением пептида NC-729.

Из диаграммы на рис.3, где опыты проводились с суммарной популяцией клеток, видно, что иммунизация мышей рекомбинантным ВПЧ16 вызывает сильный  Т-клеточный ответ, направленный, в частности,  к эпитопу, моделируемому пептидом NC-732.

Рис. 3. Т-клеточная реактивность суммарной популяции спленоцитов после 3-х кратной иммунизации мышей рекомбинантным ВПЧ16.

С CD8+-обогащенной клеточной популяцией (анализ ЦТЛ) наиболее активная пролиферация клеток наблюдалась в ответ на пептид  NC-732, а также  несколько слабее на пептид NC-732, что свидетельствует о значительном цитотоксическом потенциале рекомбинантного ВПЧ16. Отсутствие ответа клеток  к пептидам С-12, С-13 и С-14 вполне закономерно, поскольку они моделируют В-эпитопы белка L1. Иммунизация свободными пептидами, фрагментами белка Е7 HPV16 и HPV31, показала, что пептиды P-236 (35 аминокислот) и NC-725 (18 аминокислот) обладают  высокой Т-клеточной активностью, но только в сочетании с адъювантом ПМ. Использование мультивалентного иммуногена в виде смеси 3 пептидов с адъювантом ПМ также продемонстрировало наличие у препарата Т-клеточной иммуногенности. Интересно, что и сам ПМ способен активировать Т-клетки, причем его активность увеличивается при обогащении популяции CD8-лимфоцитами, т .е. возможно, он активирует специфические киллеры.

Ранние исследования по иммуногенности рекомбинантных белков HPV, получаемых в бактериальной системе экспрессии (E.coli), показывали, что уровень вырабатываемых антител в результате иммунизации довольно низкий. Хорошие результаты получали при использовании клеток насекомых (бакуловирусная система), а также дрожжей. В этом случае экспрессируемый белок L1 агрегирует в капсидоподобный ВПЧ и способен индуцировать высокий уровень протективного иммунного ответа. Система экспрессии  структурных белков в дрожжах Saccharomyces cerevisiae обладает рядом преимуществ — она  дает возможность синтезировать большие количества требуемого белка в нативной конформации, поскольку система посттранскрипционной модификации белка сходна с таковой в клетках млекопитающих, и кроме того, безопасность дрожжей признана на международном уровне (группа организмов GRAS: Generally Regarded As Save). Полученные белки, судя по всем доступным тестам, иммунореактивности с антитпептидными и моноклональными антителами, данными электрофореза и иммуноблота, электронной микроскопии, соответствуют по своим свойствам ВПЧ, полученным в других лабораториях мира и должны продуцировать вируснейтрализующие антитела. Иммунизация мышей созданным ВПЧ16 подтвердила его высокую иммуногенность на В- и Т-клеточном уровне.

Пептиды моделировали последовательности белков Е7, ответственных за активацию ЦТЛ и ТХЛ (ассоциирующиеся с МНС I и II класса, соответственно). Длинные пептиды, Р-1, Р-236 и NC-725, предназначались для иммунизации, короткие 9-12 аминокислот для анализа иммунных спленоцитов в ELISPOTе. Преимущество пептидных вакцин заключается в их безопасности и легкости их получения. Современные технологии пептидного синтеза позволяют легко нарабатывать 10-40 членные пептиды и  масштабировать их производство. Однако, их низкая иммуногенность заставляет применять конъюгаты, либо искать эффективные адъюванты. Как и следовало ожидать, эксперименты на мышах показали, что свободные пептиды из белка L1, за некоторым исключением (пептид С-14), обладали низкой иммуногенностью. Лишь конъюгация с ПО позволила повысить иммуногенность исследуемых препаратов, а коньюгация с KLH - получить высокотитражные антипептидные сыворотки, пригодные для аналитических целей. Наши эксперименты показали, что пептиды в сочетании с адъювантом ПМ индуцировали заметный антиген-специфический Т-клеточный ответ, активируя ЦТЛ и ТХЛ. 

Полученные препараты обладают несомненным профилактическим и терапевтическим потенциалом, однако решающие доказательства их активности должны быть получены при испытаниях на биологической модели и в клинических исследованиях.

Изучение роли интерферонов первого и третьего типа при респираторной вирусной инфекции. В данной работе было показано, что при инфицировании риновирусом и вирусом гриппа в эпителии респираторного тракта резко повышается экспрессия интерферонов первого ( и ) и третьего () типа. Анализ кинетики индукции данных противовирусных интерферонов в клетках респираторного эпителия выявил то, что ИФН- экспрессируются и продуцируются практически синхронно с ИФН-/. В тоже время экспрессия и продукция ИФН- выражена значительно сильнее, чем экспрессия и продукция интерферонов первого типа (Рис.4). Характерно то, что данная тенденция имела место как при инфицировании респираторного эпителия риновирусами, так и в эксперименте с вирусом гриппа типа А.

Рис. 4.Оценка уровня экспрессии и продукции интерферонов первого и третьего типа при инфицировании клеток BEAS-2B РВ 16.

В тоже время, изучение популяции мононуклеаров крови продемонстрировало обратную картину: в данных клетках преимущество на стороне интерферонов первого типа, а именно ИФН-. Очевидно, что факторы естественного иммунного ответа респираторного эпителия играют важнейшую барьерную и защитную роль по отношению к внедряющимся в организм респираторным патогенам. Более того, в последние годы было показано, что развитие вирус-индуцированной бронхиальной астмы тесно взаимосвязано с патологией в развитии факторов естественного иммунного ответа. Так при инфицировании РСВ и NDV мононуклеары периферической крови больных бронхиальной астмой продуцируют значительно меньшее количество ИФН- по сравнению с мононуклеарами, полученными от здоровых индивидуумов (Gehlhar K, 2006). Также было показано, что клетки бронхиального эпителия астматиков более чувствительны к риновирусной инфекции по сравнению со здоровыми индивидуумами вследствие нарушенной продукции ИФН-. Причём естественная резистентность клеток респираторного эпителия больных бронхиальной астмой к риновирусами полностью восстанавливалась при добавлении экзогенного ИФН- (Wark P., 2005). Наконец совсем недавние исследования продемонстрировали, что продукция ИФН- клетками бронхиоальвеолярного лаважа и бронхиального эпителия при инфицировании риновирусами in vivo также понижена у больных бронхиальной астмой (Contoli M., 2006). Таким образом, в совокупности перечисленные выше данные указывают на наличие дефицита продукции интерферонов первого и третьего типа у больных с вирус-индуцированной бронхиальной астмой, что может являться важнейшим этиопатогенетическим звеном как в формировании самой бронхиальной астмы, так и её вирус-индуцированных осложнений.

Ввиду неясности этиопатогенеза данного состояния повлиять на дефицит продукции ИФН первого и третьего типа у больных бронхиальной астмой в обозримом будущем представляется возможным лишь при заместительной терапии препаратами ИФН. В этой связи крайне любопытными представляются данные, свидетельствующие о том, что к стимуляции ИФН- чувствительны лишь два типа клеток: плазмоцитоидные дендритные клетки, представляющие собой субтип дендритных клеток, а также эпителиальные клетки (Ank N., 2008). Последнее представляется очень важным, ведь эпителиальные клетки представляют собой первый барьер на пути множества вирусных инфекций при внедрении в организм человека. Так в эксперименте на мышах было показано, что местное введение ИФН-2 во влагалище экспериментальных животных полностью предотвращало заражение ВПГ-2 (Ank N., 2008). Более того, было показано, что деплеция pDC у экспериментальных животных не приводила к снижению противовирусной защиты при интравагинальном введении ИФН- и последующем инфицировании ВПГ-2. Эти данные свидетельствуют о том, что основным механизмом действия ИФН- является локальный, местный механизм, а системный эффект ИФН- не имеет такого большого значения. Результаты, приведённые в данной диссертационной работе, свидетельствующие о преимущественной роли интерферонов третьего типа над интерферонами первого типа в антивирусной защите при респираторной вирусной инфекции бронхоэпителиальных клеток полностью соответствуют полученным другими исследователями данным. Анализ полученных данных позволяет сделать заключение о том, что, по всей видимости, интерфероны первого типа, к которым относятся уже хорошо изученные ИФН- и ИФН- играют центральную, регулирующую роль в системном противовирусном иммунном ответе, а недавно открытые интерфероны третьего типа являются ключевыми факторами местного противовирусного ответа.

       Как уже было описано выше, ВПЧ тропен к чешуйчатому эпителию, базальные клетки которого являются источником вирусной персистенции. Полученные в работе новые данные о важнейшей роли ИФН- как одного из основных факторов местной противовирусной защиты организма, открывают новые перспективы для разработки новых и усовершенствования уже существующих методов лечения заболеваний, ассоциированных с ВПЧ.

       Частые ОРВИ и вызванные ими обострения бронхиальной астмы ассоциированы с пониженной продукцией интерферонов первого и третьего типа у больных бронхиальной астмой. Ранее предпринимались попытки использовать препараты ИФН- для лечения ОРВИ, однако до сих пор их эффективность является дискутабельной, во многом ввиду сложности в подборе оптимальной дозы и доставке препаратов в клетки-мишени. Поэтому крайне перспективным на сегодняшний день представляется внедрение ИФН- в схему терапию вирус-индуцированных обострений бронхиальной астмы.

Изучение генома РСВ. Дизайн siRNA против мРНК белка Р РСВ. В качестве мишени в геноме РСВ был выбран фосфопротеин Р, являющийся меньшей субъединицей РНК-зависимой РНК-полимеразы (RdRP) и эссенциальным транскрипционным фактором для белка L (Bitko V., 2001), поэтому ингибирование синтеза субъединицы P вирусной RdRP должно приводить к угнетению основного объема вирусной транскрипции и репликации и, следовательно, трансляции вирусных белков.

Структура мРНК белка Р РСВ была изучена на основании анализа 21 нуклеотидных последовательностей, доступных в банке данных NCBI (Национальный центр биотехнологической информации, США). Выбранные молекулы siRNA были нацелены на консервативные участки мРНК белка Р в пределах открытой рамки считывания и соответствовали формулам AAN19TT, NAN19NN, NARN17YNN, NANN17YNN (где N – любое нуклеиновое основание, R – пуриновое нуклеиновое основание, Y – пиримидиновое нуклеиновое основание). В соответствии с критериями, рекомендованными Elbashir с соавторами (Elbashir S.M., 2001) были синтезированы шесть уникальных потенциально наиболее эффективных последовательностей siRNA к мРНК белка Р.

1) si01.        мРНК мишень        CGAUAAUAUAACUGCAAGAUU (401-419) 

siRNA                CGAUAAUAUAACUGCAAGAdTdT
dTdTGCUAUUAUAUUGACGUUCU

2) si03.        мРНК мишень        UGAUCUAUCACUUGAAGAUUU (719-737)

siRNA                UGAUCUAUCACUUGAAGAUdTdT
        3’ dTdTACUAGAUAGUGAACUUCUA

3) si05.        мРНК мишень        GUAGUAGCAAGUGCAGGACCU (474-492)

siRNA                 GUAGUAGCAAGUGCAGGACdCdT
        3’ dTdCCAUCAUCGUUCACGUCCUG

4) si07.        мРНК мишень        GCAAGUGCAGGACCUACAUCU (480-498)

siRNA                GCAAGUGCAGGACCUACAUdCdT

        3’ dTdCCGUUCACGUCCUGGAUGUA

5) si09.        мРНК мишень        UACUAGGAAUGCUUCACACAUU (451-470)

siRNA                UACUAGGAAUGCUUCACACAdTdT

  3’ dAdCCACAGAGAGUUAGGUUGUAG

6) si11.        мРНК мишень        UUGAUAACAAUGAAGAAGAAU (343-361)

siRNA                UUGAUAACAAUGAAGAAGAdAdT

        3’ dTdAAACUAUUGUUACUUCUUCU

На 3’-концах всех siRNA были помещены дезоксирибонуклеиновые остатки, что увеличивает их устойчивость к РНКазам (Elbashir S.M., 2001). 

7) siMix. В качестве седьмой опытной siRNA использовали смесь этих шести специфических siRNA, смешанных в равных пропорциях.

Специфичность действия siRNA контролировали использованием siRNA к мРНК белка VP4 риновируса 16 серотипа, показавшей высокую противориновирусную активность в культуре клеток (Krista M.Ph., 2004).

siHRV         мРНК мишень       GAUGCAGCUUCCAGUGGUGUU (728–746)

siRNA               GAUGCAGCUUCCAGUGGUGdTdT

        3’ dTdTCUACGUCGAAGGUCACCAC

Оценка антивирусной активности siRNA против мРНК белка Р РСВ в культуре клеток.

Микроскопическая оценка состояния зараженных вирусом клеток. Изменение структуры монослоя клеток МА104 под действием вируса наблюдали в динамике при помощи микроскопа. В клетках обработанных неспецифическими siRNA (siHRV и siGLO) и необработанных siRNA через 24 часа после заражения при микроскопическом исследовании монослоя наблюдали единичные синцитии. Через 48 часов после заражения наблюдали выраженное ЦПД, которое проявлялось в формировании характерных крупных синцитиев в монослое. Через 72-96 часов после инфицирования в этих лунках оставалось около 50% прикрепленных клеток, из них примерно половина в составе обширных синцитиев, остальные клетки находились в составе всплывших синцитиев. Через 120 часов после заражения под действием вируса монослой полностью разрушается.

Напротив, через 48, 72 и 96 часов после заражения в лунках, обработанных специфическими siRNA визуально синцитии не определялись, монослой выглядел интактным. Более того, состояние клеток к 3-4 суткам даже улучшилось, что было отмечено по интенсивной клеточной пролиферации. В клетках, обработанных специфическими siRNA, признаков ЦПД не наблюдали до 7-10 суток, в зависимости от использованной siRNA.

В отдельном эксперименте было показано, что даже однократная обработка клеток специфическими siRNA через 4 часа после инфицирования обеспечивает длительное угнетение образования синцитиев по сравнению с неспецифическими siRNA. В этих лунках через 48-72 часа после заражения синцитии также визуально не определялись. Через 96 часов в лунках с одной трансфекцией визуально определялись единичные маленькие синцитии с 2-3 ядрами. Активное образование синцитиев наблюдали на 5-7 сутки после заражения в зависимости от использованной siRNA.

Оценка противовирусной активности siRNA методом титрования. Титр вируса в клетках, обработанных различными специфическими siRNA против РСВ, при оценке титра по ЦПД через 48, 72 и 96 часов после заражения был значительно ниже, чем в обработанных контрольной неспецифической siRNA. Наиболее эффективные варианты siRNA снижали титр вируса в 200-300 раз по сравнению с контрольными siRNA. Ниже в виде гистограмм (рисунок 5) представлены результаты определения титра вируса через 48, 72 и 96 часов после инфицирования. По оси абсцисс расположены варианты siRNA – опытные и контрольная (siHRV). По оси ординат титр вируса в log10ТЦД50 в мл культуральной жидкости. *** - P<0,001.

Рисунок 5. Титрование вируса через 48, 72 и 96 часов после инфицирования и обработки siRNA.

Оценка противовирусной активности siRNA путем определения в культуральной жидкости количества вирусной РНК методом ПЦР в реальном времени. При проведении ПЦР в реальном времени зафиксировано значительное снижение количества копий вирусной РНК - до 40 раз по сравнению с контрольными siRNA. На гистограммах (рисунки 6) представлены результаты определения количества вирусной РНК методом ПЦР в реальном времени через 48, 72 и 96 часов. По оси абсцисс расположены варианты siRNA – опытные и контрольная (siHRV). По оси ординат log10 количества вирусной РНК в мл культуральной жидкости соответственно. ** - Р<0,01, *** - P<0,001

Рисунок 6. Результаты определения количества вирусной РНК в вируссодержащей культуральной жидкости, 48, 72 и 96 часов после заражения и обработки siRNA.

В диссертационной работе показано, что siRNA посредством сайленсинга вирусных генов эффективно угнетает вирусную репликацию. Применение наномолярных концентраций siRNA приводит к достоверному снижению титра вируса, до 200-300 раз в культуре клеток. Известно, что вещество обычно считается потенциально успешным в качестве фармакологического терапевтического средства, если оно эффективно в культуре клеток в субмикромолярных концентрациях.

При определении количества вирусной РНК при помощи ОТ-ПЦР  степень уменьшения количества вирусной РНК в культуральной жидкости при обработке siRNA достигла 30-40 раз. Более эффективное снижение титра вируса (в 200-300 раз) при оценке действия siRNA по ЦПД по сравнению с количественным определением вирусной РНК объясняется нарушениями в сборке вирионов под воздействием siRNA. siRNA к мРНК белка Р РСВ вызывает сайленсинг гена ключевого белка, что, возможно, ведет к сборке  дефектных вирионов, содержащих недостаточное количество белка Р, но содержащих РНК. Образуется меньшее количество инфекционных полноценных вирионов, что проявляется снижением вирусных титров в культуральной жидкости.

Комплексный анализ данных, полученный в экспериментах на культуре клеток при микроскопическом исследовании, титровании вируса и ПЦР позволяет сделать заключение о том, что мРНК белка Р является удачной мРНК-мишенью для создания антивирусного средства против РСВ на основе siRNA.

Важным моментом в подборе участка мРНК мишени является проблема «ускользающих мутаций» вирусов и необходимость подбора siRNA к консервативным участкам генома. В настоящей работе показано, что эффективность смеси siRNA (siMix) в культуре клеток не уступает самым удачным siRNA, входящим в её состав. Таким образом, смесь нескольких siRNA может быть использована как универсальный препарат против РСВ, обладающий противовирусной активностью в отношении большого разнообразия генетических вариантов вируса. В принципе препарат siMix может содержать siRNA не только к одной, а сразу к нескольким разным мРНК-мишеням, кодирующим ключевые вирусные белки. Таким образом, можно одновременно воздействовать на различные звенья патогенной активности вируса и добиваться более эффективного снижения активности вирусной репликации.

Оценка антивирусной активности siRNA против мРНК белка Р РСВ в экспериментальной модели инфекции на мышах. Для оценки активности siRNA в мышиной модели РСВ-инфекции использовали образцы siRNA, показавшие наибольшую эффективность в модели in vitro. Этими образцами стали опытные si01, si03, si07 и контрольная siHRV.

По данным большинства исследователей экспериментальную модель РСВ получают при использовании мышей линии BALB/c и РСВ штамм А2, к которому мыши более восприимчивы (Taylor G., 1984; Van Schaik S.M., 1998; Sudo K., 1999; Kong X., 2005; Bitko V., 2007). Но в литературе также встречаются данные об удачном проведении экспериментов in vivo с применением РСВ штамм Long (Bitko V., 2005; Cianci C., 2004).

РСВ вводили мышам в смеси с siRNA без применения специальных средств доставки siRNA. В перспективе применение siRNA без носителей является экономически более эффективным, а также снижает риск побочных эффектов. С другой стороны, с помощью средств для доставки siRNA с клетку можно добиться более эффективного сайленсинга вирусных генов.

В данной работе препарат siRNA вводился эндотрахеально, что позволяло доставлять siRNA непосредственно на эпителий респираторного тракта – основной, первичный очаг репликации респираторных  вирусов. Для использования siRNA против вирусов, поражающих другие органы и ткани потребуются специальные средства доставки, которые обеспечат транспортную функцию через различные гистологические барьеры, защитную функцию от разрушения и сохранение функциональных свойств siRNA.

Титрование вируса в бронхоальвеолярных смывах их легких мышей и патологоанатомическая оценка состояния легких. При титровании вируса из легочных смывов не удалось получить результаты, которые характеризовали бы разницу в титре между опытными и контрольной группой. Вероятно, это связано с недостаточной чувствительностью применяемого метода титрования вируса по ЦПД. Однако было замечено, что в группах обработанных опытными специфическими siRNA удалось выделить вирус в культуре клеток из легких только у 1 мыши из 18, т.е. у 5% мышей. Тогда как из легких 12 мышей контрольной 4 группы (siHRV) и 5 группы (не обработанной siRNA) удалось выделить вирус у 42% мышей. Это указывает на снижение репродукции вируса в легких мышей, обработанных специфическими siRNA.

Снижение репродукции вируса в легких мышей, обработанных специфическими siRNA, подтверждаются видимыми поражениями в легких, которые мы наблюдали при вскрытии грудной клетки мышей. Легкие мышей из группы зараженных респираторным синцитиальным вирусом без введения siRNA и мышей из контрольной группы (siHRV) выглядели отечными, цианотичными, неравномерной окраски с участками уплотнений и очагами кровоизлиянияний, по консистенции они были неэластичными, рыхлыми, что соответствовало патологоанатомической картине массивной двухсторонней полисегментарной очагово-сливной геморрагической пневмонии. Напротив, в легких мышей из групп зараженных мышей, которые получили опытные специфические siRNA, видимых патологических изменений ткани легких не определялось – они были равномерной «здоровой» светлорозовой окраски, эластичной, упругой консистенции.

Определение количества вирусной РНК в гомогенатах легких методом ПЦР в реальном времени. В гомогенатах легких мышей на 6 сутки после эндотрахеального введения респираторного синцитиального вируса и si01 при проведении ПЦР-РВ обнаружено статистически достоверное снижение количества копий специфической вирусной РНК в 14 раз по сравнению с контролем (siHRV). В гомогенатах легких мышей получивших эндотрахеально респираторный синцитиальный вирус и si03 зафиксировано снижение количества копий специфической вирусной РНК в 7 раз. При проведении ПЦР-РВ в гомогенатах легких мышей, которым вводились РСВ и si07, зарегистрировано статистически недостоверное снижение количества копий специфической вирусной РНК по сравнению с контролем. Результаты определения количества вирусной РНК методом ПЦР-РВ представлены в виде гистограммы (рисунок 7).

Выявление наиболее эффективных siRNA против РСВ. Экспериментальные образцы si01 и si03 наиболее эффективно подавляли репликацию вируса в культуре клеток по сравнению с другими экспериментальными образцами. Эти же образцы показали лучшие результаты по снижению вирусной репликации в модели инфекции на мышах. Указанные siRNA соответствуют формуле AAN19TT и обладают высокой устойчивостью к эндонуклеазам (Barik S., 2004). А также, возможно, более эффективным взаимодействием с комплексом RISC.

Специфичность siRNA очень убедительна: несовпадение на одну пару оснований между siRNA и мРНК-мишенью делает невозможным сайленсинг (Elbashir S.M., 2001). Трансфекция клетки siRNA против одной вирусной мРНК не влияет на транскрипцию других мРНК. Так использование siRNA к мРНК белка VP4 риновируса 16 серотипа не влияло на титр РСВ. Кроме того, применение реагента для контроля трансфекции siGLO (siRNA к мРНК белка ядерной мембраны клетки ламина) также не виляло на титр РСВ. Напротив, использование siRNA к мРНК белка Р РСВ продемонстрировало четкое вирусспецифическое действие - исследуемые siRNA эффективно снижали титр РСВ. Применение siRNA приводит к сайленсингу ключевого вирусного белка, никак не влияя на нормально протекающие процессы в клетке.

Возможно применение лекарственного средства на основе siRNA против РСВ и с профилактической, и с лечебной целью. Использование siRNA до инфицирования или на начальных этапах инфекции позволяет наиболее эффективно подавлять вирусную репликацию. Тем не менее, применение siRNA на более поздних стадиях инфекции также оправдано – использование специфических siRNA должно ограничивать активность инфекции, уменьшать выраженность симптомов и сокращать длительность течения заболевания.

Респираторные вирусы, и особенно РСВ, обладают высокой тропностью к эпителию респираторного тракта. Поэтому ингаляционное введение препарата обеспечивает прицельную доставку siRNA к очагу инфекции, что является идеальным условием для решения проблемы способа введения лекарственного средства в фармакологии. Ингаляционное введение siRNA является сравнительно неинвазивным и безболезненным. В настоящей работе эндотрахеальное введение мышам «голой» siRNA без средств доставки эффективно оказывало противовирусных эффект, что согласуется с данными других исследователей с ингаляционным или интраназальным введением мышам «голой» siRNA (Bitko V., 2005; Tompkins S.M., 2004).  Ингаляционное введение «голой» siRNA исключает потенциальный риск возможного побочного действия средства доставки. Высокую эффективность «голой» siRNA без носителей ещё предстоит объяснить. Возможно, это связано с тем, что ткани респираторного тракта, в частности легкие, более восприимчивы к диффузии малых молекул или становятся таковыми во время инфекции.

Безусловно, очень привлекательной является сравнительная дешевизна методики на основе siRNA. Синтез олигонуклеотидов в настоящее время относительно доступен и прост. Кроме того, в России недавно появились компании, которые синтезируют siRNA. Этот факт дает siRNA большое преимущество, например, по сравнению со средствами на основе моноклональных антител.

Несмотря на то что, молекулярная биология и эпидемиология РСВ хорошо изучены, средств для эффективного лечения и профилактики РСВ-инфекции до сих пор не разработано. В данном исследовании получены убедительные данные о том, что siRNA против мРНК белка Р РСВ эффективно подавляют репродукцию вируса, поэтому терапевтическое использование siRNA кажется весьма перспективным. Следует рассматривать синтетические молекулы siRNA в качестве средства высоко эффективного и специфического подавления экспрессии генов цитоплазматической вирусной РНК. На сегодняшний день существует потребность в создании эффективной противовирусной терапии для предотвращения и лечения состояний и заболеваний, связанных с респираторными вирусами, в частности вирус-индуцированной бронхиальной астмы. Возможность использования siRNA в качестве эффективного специфического противовирусного средства, безусловно, должна реализоваться в разработке надежной, безопасной и недорогой противовирусной терапевтической методики.

Выводы

1. Получены дрожжевые репликативные плазмиды, предназначенные для экспрессии белка L1 папилломавируса человека серотипов 16 и 18 в клетках дрожжей Saccharomyces cerevisiae.

2. Отработаны протоколы выделения ВПЧ. Препараты ВПЧ из белков L1 HPV cеротипов 16 и 18  наработаны в количестве 1,5 мг. Анализ препаратов методами визуализации в геле, иммуноферментными методом при помощи специфических антител, а также методом электронной микроскопии доказал соответствие полученных в работе частиц искомым вирусоподобным частицам.

3. Препараты ВПЧ из белков L1 HPV cеротипов 16 и 18 являются высокоиммуногенными препаратами.

4. Проанализированы аминокислотные последовательности внутреннего белка Е7 ВПЧ 16 и 31. Выбраны участки, соответствующие Т-клеточным эпитопам ВПЧ. Синтезированные пептиды обладали специфическими иммуногенными свойствами при использовании с иммуностимулирующими препаратами.

5. Комбинированное использование полученных вирусоподобных частиц, состоящих из белка L1, с пептидами, имитирующими Т-клеточные эпитопы белка Е7, перспективно в контексте создания лечебно-профилактической вакцины против вируса папилломы человека.

6. Интерфероны третьего типа являются основными интерферонами, продуцируемыми клетками респираторного эпителия при вирусной инфекции.

7. Белок Р является успешной мишенью для эффективного подавления РСВ при помощи siRNA. siRNA к мРНК белка Р РСВ эффективно снижает репликацию респираторно-синцитиального вируса in vitro в культуре клеток.

8. siRNA к мРНК белка Р респираторно-синцитиального вируса эффективно снижает репликацию РСВ in vivo на мышах. Экспериментальные данные, полученные in vitro, подтверждены in vivo.

9. Выявлены наиболее эффективные siRNA против мРНК белка Р респираторно-синцитиального вируса. siRNA обладает специфическим действием, не оказывает влияния на уровень транскрипции других белков

10. siRNA может использоваться в качестве специфического противовирусного средства, не влияющего на нормально протекающие процессы в клетке.

11. siRNA может применяться в качестве противовирусного средства без специальных средств доставки в чистом виде при эндотрахеальном/ингаляционном введении, что может использовано при создании лечебно-профилактических средств против респираторных вирусов.

12. Использование siRNA в качестве противовирусного средства представляется сравнительно простой и недорогой методикой, требующей лишь выбора белка-мишени вируса, знания методики дизайна siRNA и синтеза олигонуклеотидов, который в настоящее время стал доступен.

13. Теоретически обоснован и экспериментально подтверждён метод создания эффективного лекарственного средства против РСВ, одного из основных этиологических факторов вирус-индуцированной бронхиальной астмы, с использованием механизма интерференции РНК.

Список работ, опубликованных по теме диссертации:

  1. Хаитов М.Р., Трофимов Д.Ю., Петрова Т.В., Подчерняева Р.Я., Хижнякова Т.М., Соколова М.В. Молекулярная диагностика вирусных инфекций при бронхиальной астме. Сообщение №1. Подход к разработке ПЦР диагностикумов для идентификации вирусов – этиологических факторов бронхиальной астмы. Аллергия, астма и клиническая иммунология, 2000, №10, с.3-7.
  2. Хаитов М.Р. Изучение роли респираторно-синцитиального вируса в этиологии и патогенезе бронхиальной астмы. «Фундаментальные науки и прогресс клинической медицины». Материалы II Российской конференции молодых учёных России с международным участием (24-28 апреля 2001, Москва). 2001, т.1, с.179.
  3. Хаитов М.Р. Изучение роли респираторно-синцитиального вируса в этиопатогенезе бронхиальной астмы. Материалы 4-го Конгресса РААКИ «Современные проблемы аллергологии, иммунологии и иммунофармакологии» (29-31 мая 2001 г., Москва). М., ВИНИТИ, 2001, т.2, с.232.
  4. Khaitov M.R. Investigation of the role of respiratory syncitial virus in etiology and pathogenesis of atopy and asthma. Allergy, 2001, suppl. 68, v. 56, p. 158.
  5. Хаитов М.Р. Острые респираторные вирусные инфекции и бронхиальная астма. Клеточные и молекулярные аспекты проблемы. Журн. микробиол. эпидемиол. и иммунобиол., 2002, №4, с.84-93.
  6. Хаитов М.Р., Алексеев Л.П., Трофимов Д.Ю., Болдырева М.Н., Петрова Т.В., Яковлева К.П. Молекулярная диагностика вирусных инфекций при бронхиальной астме. Сообщение №2. Исследование роли респираторных вирусов в возникновении приступов бронхиальной астмы. Аспекты МНС-обусловленной предрасположенности к вирус-индуцированной бронхиальной астме. Аллергия, астма и клиническая иммунология, 2002, №8, с.17-21.
  7. Khaitov M.R., Trofimov D.U., Petrova T.V. Investigation of the role of respiratory  viruses  in the development of asthma. Allergy, 2002, vol.57, suppl.73, р.296.
  8. Хаитов М.Р. Роль респираторных вирусов в патогенезе бронхиальной астмы. Иммунология, 2003, т.24, с.58-65.
  9. Хаитов М.Р., Алексеев Л.П., Трофимов Д.Ю., Болдырева М.Н., Петрова Т.В., Яковлева К.П. Изучение роли респираторных вирусов в этиологии и патогенезе бронхиальной астмы. Иммунология, 2003, т.24, №2, с.96-99.
  10. Khaitov M.R., Trofimov D.U., Petrova T.V., Yakovleva K.P., Ilina N.I., Yartsev M.N., Boldyreva M.N., Alexeev L.P. Investigation of respiratory viruses role in asthma development. Clinical Immunology and Allergy in Medicine. JGC Editions, 2003, p. 403-409.
  11. Хаитов М.Р., Трофимов Д.Ю., Болдырева М.Н., Петрова Т.В., Яковлева К.П., Ярцев М.Н., Ильина Н.И., Алексеев Л.П., Зверев В.В., Киселёв О.И., Гервазиева В.Б., Семенов Б.Ф. Разработка ПЦР-диагностикума для детекции респираторно- синцитиального вируса. Физиология и патология иммунной системы, 2004, № 2, с.85-91.
  12. Хаитов М.Р., Трофимов Д.Ю., Петрова Т.В., Яковлева К.П., М.Н.Ярцев, Алексеев Л.П., Ильина Н.И. Риновирусная инфекция при атопической бронхиальной астме у детей. Российский аллергологический журнал, 2004, №1, с.30-36.
  13. M. R. Khaitov, D. U. Trofimov, T. V. Petrova, K. P. Yakovleva, L. P. Alexeev. Evaluation of the role of rhinoviruses, adenoviruses, RS-viruses, PIV 1, PIV 2, PIV 3 and coronaviruses OC43 and 229E in exacerbations of asthma in children. Abstract Book XXIII EAACI Congress, 2004 Amsterdam, p. 37.
  14. M. R. Khaitov, D. U. Trofimov, T. V. Petrova, K. P. Yakovleva, M. N. Boldyreva, M. N. Yartsev, N. I. Ilina, L. M. DuBuske, L. P. Alexeev. Mechanisms of Viral Impact on Asthma Exacerbations. The Journal of Allergy and Clinical Immunology, 2004, Volume 113, Supple. 2 , p. 952.
  15. Хаитов М.Р., Лаза-Станца В., Эдвардс М.Р., Джонстон С.Л. Оценка α-, β- и λ-интерферонового ответа при острых респираторных вирусных инфекциях. Физиология и патология иммунной системы, 2005, №9, с. 3-12.
  16. Хаитов М.Р. Интерфероны первого типа при вирус-индуцированных приступах бронхиальной астмы. Аллергология и иммунология в педиатрии. 2005, № 6, с.166.
  17. Хаитов М.Р., Акимов В.С. Возможности применения технологий RNAi для подавления репликации респираторно-синцитиального вируса, одного из основных этиологических агентов приступов бронхиальной астмы. Физиология и патология иммунной системы, №5, 2005, с. 3-6.
  18. Хаитов М.Р., Акимов В.С. Технология RNAi. Возможности применения siRNA для подавления репликации респираторных вирусов, основных этиологических агентов приступов бронхиальной астмы. Иммунология, 2005, № 4, с. 249-255.
  19. Khaitov M., Laza-Stanca, V., Edwards, M., Contoli, M., Walton, R., Johnston SL. Type 1 and type 3 interferon expression in response to respiratory viruses. Abstract Book XXV EAACI Congress, 2006 Vienna, Austria, 10-14 June 2006 p. 26.
  20. Litvin  L.S., Khaitov M.R. , Babakhin A.A. , Stetzenko O.N.*, Voronkova L.N., Ivanova A.S. Asthma modeling using BALB/c and (CBAxC57BL/6)F1 mice. Abstract Book XXV EAACI Congress, 2006 Vienna, Austria, 10-14 June 2006 p.203.
  21. Хаитов М.Р., Акимов В.С. Интерференция РНК. Успехи современной биологии. Том 126, №3, 2006, с. 242-249.
  22. Хаитов М.Р., Лаза-Станца В. , Эдвардс М.Р. , Джонстон С.Л Продукция альфа-, бета и лямбда-интерферонов эпителиальными клетками и мононуклеарными клетками при ОРВИ. Журн. микробиол. эпидемиол. и иммунобиол., 2006,  т.7, с. 63-69.
  23. Khaitov M.R., Akimov V.S., Faizuloev E.B., Nikonova A.A., Alexeev L.P., Zverev V.V. and DuBuske L.M.. Inhibition of Respiratory Syncytial Virus (RSV) Replication in Cell Culture by Small Interfering RNA (siRNA). Journal of Allergy and Clinical Immunology, Volume 119, Issue 1, Supplement 1, January 2007, p. S233-S234.
  24. Khaitov M.R., Akimov V.S., Faizuloev E.B., Nikonova A.A., Trofimov D.U., Alekseev L.P., Sominina A.A., Zverev V.V., DuBuske L.M. siRNA mediated inhibition of RSV replication. J Allergy, 2007, v.62 (s.83), p.127.
  25. Khaitov M.R., Akimov V.S., Faizuloev E.B., Nikonova A.A., Trofimov D.U., Alekseev L.P., Sominina A.A., Zverev V.V., DuBuske L.M. Inhibition of RSV infection in vitro by small interfering RNAs. 2007 Annual Meeting ACAAI. November 8-14. p. 33.
  26. Khaitov MR, Laza-Stanca, V., Edwards M., Walton, R., Contoli, M., Papi A., Johnston SL Alpha-, beta-, lambda-interferon expression during rhinovirus infection. Abstract Book IX International Symposium on Respiratory Viral Infections, 2007, p 15.
  27. Акимов В.С., Хаитов М.Р., Файзулоев Е.Б., Никонова А.А., Трофимов Д.Ю., Алексеев Л.П., Соминина А.А., Зверев В.В. Подавление репродукции респираторно-синцитиального вируса методом siRNA. Вопросы вирусологии. №2, 2007, с. 8-12.
  28. Хаитов М.Р., Акимов В.С., Файзулоев Е.Б., Никонова А.А., Трофимов Д.Ю., Алексеев Л.П., Соминина А.А., Зверев В.В. Разработка новых подходов к созданию антивирусных препаратов. Сообщение №1: Подавление репродукции респираторно-синцитиального вируса методом siRNA. Физиология и патология иммунной системы, 2007, №9, с. 8-13.
  29. Хаитов М.Р., Акимов В.С., Файзулоев Е.Б., Никонова А.А., Трофимов Д.Ю., Алексеев Л.П., Соминина А.А., Зверев В.В. Молекулярно-генетические подходы к подавлению репродукции респираторных вирусов. Российский аллергологический журнал, 2007, №3 приложение 1, с. 80.
  30. Петров Р.В., Хаитов М.Р., Андреев С.М., Петрухина А. О., Гарманова А. В., Бабахин А.А., Литвин Л.С., Коробова С.В., Литвина М.М., Беневоленский С.В., Сурина Е.Р. , Козлов Д.Г. , Абянова А.Р., Смирнова О.В. Разработка профилактической и терапевтической вакцины против вируса папилломы человека. Сообщение № 1: Синтез и иммунологическая активность рекомбинантных белков и пептидов из вируса папилломы человека серотипов 16, 18 и 31. Иммунология, 2007, т. 28, № 6, с. 342-352.
  31. Петров Р. В., Хаитов М. Р., Андреев С. М., Беневоленский С. В., Смирнова О.В. Иммуногенные свойства рекомбинантных и синтетических пептидов вируса папилломы человека. Доклады Академии Наук, 2008, том 421, № 2, с. 267–273.
  32. Khaitov MR, Laza-Stanca V, Edwards MR, Walton RP, Rohde G, Contoli M, Papi A, Stanciu LA, Kotenko SV, Johnston S. L. Respiratory Virus Induction of Alpha-, Beta- and Lambda-interferons in Bronchial Epithelial Cells and Peripheral Blood Mononuclear Cells. Allergy, 2008, in press.
  33. Царёв С.В., Хаитов М.Р., Лусс Л.В., Трофимов Д.Ю. Факторы, провоцирующие обострение при различных формах бронхиальной астмы. Физиология и патология иммунной системы. 2008, № 2, с. 8-14.





© 2011 www.dissers.ru - «Бесплатная электронная библиотека»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.