WWW.DISSERS.RU

БЕСПЛАТНАЯ ЭЛЕКТРОННАЯ БИБЛИОТЕКА

   Добро пожаловать!


 

УЧРЕЖДЕНИЕ РОССИЙСКОЙ АКАДЕМИИ НАУК

ИНСТИТУТ БИООРГАНИЧЕСКОЙ ХИМИИ

ИМ. АКАДЕМИКОВ М.М. ШЕМЯКИНА И Ю.А. ОВЧИННИКОВА

На правах рукописи

ОВЧИННИКОВА Татьяна Владимировна

Структурно-функциональное исследование

природных пептидных антибиотиков

03.01.06 – Биотехнология (в том числе бионанотехнологии)

02.00.10 – Биоорганическая химия 

Диссертация

в виде научного доклада

на соискание ученой степени доктора химических наук

Москва – 2011

Официальные оппоненты: академик РАН и РАМН,

                                       доктор биологических наук,

                                профессор Ткачук Всеволод Арсеньевич

член-корреспондент РАН,

доктор химических наук, 

профессор  Кочетков Сергей Николаевич

член-корреспондент РАН,

доктор химических наук,

профессор Северин Евгений Сергеевич

Ведущая организация:        Учреждение Российской академии наук

Институт биохимии им. А.Н. Баха РАН

Защита состоится «___»  ___________ 2011 г. в ___ час. на заседании Совета по защите докторских диссертаций Д 212.120.01 Государственного образовательного учреждения высшего профессионального образования «Московская государственная академия тонкой химической технологии имени М.В.Ломоносова» (МИТХТ  им. М.В.Ломоносова)  по адресу: 119571 Москва, проспект Вернадского, 86.

С диссертацией в виде научного доклада можно ознакомиться в библиотеке Государственного образовательного учреждения высшего профессионального образования «Московская государственная академия тонкой химической технологии имени  М.В.Ломоносова» (МИТХТ им. М.В.Ломоносова).

Диссертация в виде научного доклада разослана «___»  ___________ 2011 г.

Учёный секретарь

диссертационного совета

к.х.н.                                                                                        А.И.Лютик

ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ

Актуальность исследования.

Cтремительный рост бактериальных инфекций, резистентных к антибиотикам, диктует насущную необходимость создания новых терапевтических антибактериальных агентов. В ряде случаев антибиотики из имеющегося арсенала лекарственных средств уже не обеспечивают эффективного контроля над возбудителем при развитии хронических и рецидивирующих инфекционных заболеваний. Ряд штаммов Mycobacterium tuberculosis, Enterococcus faecium и Pseudomonas aeroginosa все труднее подавляются конвенциальными антибиотиками. Возрастающая резистентность наблюдается также в отношение таких распространенных патогенов человека, как Staphylococcus aureus и Staphylococcus pneumoniae. Открытие пептидных антибиотиков и изучение их биологических функций показывает, что эти природные соединения являются перспективными молекулами для создания новых антимикробных средств.

В процессе эволюции  многоклеточные организмы выработали эффективные механизмы  защиты от патогенов.  Лимфоцитарный иммунитет возник лишь с появлением челюстных рыб и  существует менее чем у 2% видов многоклеточных организмов. Однако в первые часы взаимодействия с патогеном даже те животные, которые обладают способностью вырабатывать антитела, могут полагаться только на защитные механизмы системы врожденного иммунитета. Эндрогенные антимикробные пептиды (далее АМП) являются неотъемлемыми молекулярными факторами системы врожденного иммунитета организмов, обеспечивающими их выживание в окружении потенциальных патогенов (бактерий, грибков, простейших, вирусов). Результаты исследований структурного разнообразия и распространения АМП  в природе дают основание полагать, что каждый биологический вид вырабатывает свой уникальный набор защитных пептидов, позволяющий ему успешно бороться с окружающей его патогенной микрофлорой. В настоящее время определены структуры около тысячи природных пептидных антибиотиков, выделенных из различных тканей беспозвоночных и позвоночных животных,  растений, грибов, бактерий и обладающих способностью инактивировать широкий спектр микроорганизмов. Поиск и исследование новых АМП позволяет лучше понять закономерности функционирования врожденного иммунитета у человека. По мере углубления наших знаний о пептидных антибиотиках  появляется все больше сведений об их участии в  процессах регуляции иммунитета и регенерации тканей.

Наряду с фундаментальными исследованиями структурно-функциональных свойств АМП важное прикладное значение имеют работы по созданию эффективных лекарственных средств на их основе. Природные пептиды могут стать прототипами новых антибиотиков широкого спектра действия, способных решить проблему резистентности к существующим антимикробным средствам. Подавляющее большинство АМП относятся к мембранотропным антибиотикам, поэтому развитие резистентности патогенов к ним менее вероятно из-за низкоизбирательного механизма их действия и возможно только при  существенных  изменениях структуры и свойств клеточной мембраны. Кроме того, многие АМП усиливают действие традиционных антибиотиков. Известно, что длительная антибиотикотерапия в ряде случаев вызывает состояние иммунодефицита и эндотоксемию, однако многие АМП наряду с антибиотической обладают иммуномодулирующей и эндотоксин-нейтрализующей активностью.  Все это создаёт предпосылки для создания новых эффективных антибиотических лекарственных средств на основе природных пептидных антибиотиков, лишенных  перечисленных выше недостатков. Учитывая наличие выраженной антибиотической и иммуномодулирующей активности  у  природных АМП, многие зарубежные фармацевтические компании уже приступили к созданию  нового класса антибиотиков на их основе, а первые из них уже проходят клинические испытания. Структурно-функциональные исследования природных пептидных антибиотиков могут внести существенный вклад в развитие этого перспективного направления медико-биологической науки, а разработка способов их получения с целью создания на их основе лекарственных средств нового поколения  является  одной из актуальных задач современной биотехнологии.

Диссертация выполнялась по разделам  основных направлений научных исследований ИБХ РАН «Структура и функции белков и пептидов” и „Биотехнология”, утвержденных Ученым Советом ИБХ РАН. Работа проводилась при поддержке РФФИ; ФЦП «Научные и научно-педагогические кадры инновационной России» на 2009-2013 годы; ФЦП «Исследования и разработки по приоритетным направлениям развития научно-технологического комплекса России на 2007-2012 годы»; ФЦП «Национальная технологическая база» на 2007-2011 годы; целевой программы Президиума РАН «Фундаментальные науки – медицине».

Цель и задачи исследования. 

Цель данной диссертационной работы состоит в исследовании структуры, биологических свойств и молекулярных механизмов действия природных эндогенных пептидных антибиотиков, а также в разработке  биотехнологических способов их получения. Объектами исследования являются антимикробные пептиды ареницины из целомоцитов морского червя Arenicola marina [тип – кольчатые черви (Annelida), класс – многощетинковые (Polychaeta)]; аурелин из мезоглеи сцифоидной  медузы Aurelia aurita [тип – кишечнополостные (Cnidaria), класс – сцифоидные (Scyphozoa)]; буфорин из желудка азиатской жабы Bufo bufo gargarizans [тип – хордовые (Chordata),  класс – земноводные (Amphibia),  отряд – земноводные бесхвостые (Anura), семейство – жабы настоящие (Bufonidae)];  дефенсин и липид-траспортирующий белок из чечевицы обыкновенной Lens culinaris [отдел – покрытосеменные (Magnoliophyta), класс – двудольные  (Dicotyledones), порядок – бобовоцветные (Fabales), семейство – бобовые (Fabaceae), подсемейство  - мотыльковые (Faboideae)]; зервамицин и антиамебин из мицелиальных  спорообразующих грибов Emericellopsis salmocynnemata и Emericellopsis minima  [отдел – настоящие грибы (Eumycota), подотдел – аскомицеты (Ascomycotina), класс - эуаскомицеты (Euascomycetes)]; латероцидин и латероцин из аэробной грам-положительной бактерии  Brevibасillus laterosporus; лихеницидин из термофильной грам-положительной бактерии Bacillus licheniformis.  В соответствии с поставленной целью были сформулированы следующие задачи:

1. Изучить структуру и свойства  антимикробных пептидов ареницинов, аурелина, дефенсина и липид-транспортирующих белков чечевицы,  зервамицина, антиамебина, латероцидина, латероцина, лихеницинов.

2. Разработать биотехнологические способы получения ареницинов, аурелина,  буфорина, дефенсина и липид-транспортирующего белка чечевицы в искусственных экспрессирующих системах, включая методики их выделения и очистки.

Научная новизна работы.

Все результаты, изложенные в настоящей работе, получены впервые.

1. Впервые установлена структура новых антимикробных пептидов ареницинов из целомоцитов морского кольчатого червя Arenicola marina, нового антимикробного пептида аурелина из мезоглеи сцифоидной  медузы Aurelia aurita, нового дефенсина и новых липид-траспортирующих белков из семян чечевицы Lens culinaris, новых антимикробных пептидов латероцидина и латероцина из штаммов аэробных грам-положительных бактерий  Brevibасillus laterosporus, новой двухкомпонентной системы лантибиотиков из термофильных грам-положительных бактерий  Bacillus lichenifromis. Впервые определены полные  нуклеотидные последовательности кДНК, кодирующих белки-предшественники ареницинов, аурелина, дефенсина и липид-траспортирующих белков чечевицы, лихеницидина и  соответствующие им  полные аминокислотные последовательности белков-предшественников.

2. Впервые сконструированы биотехнологические системы для гетерологичной экспрессии ареницина, аурелина, буфорина,  дефенсина и липид-транспортирующего белка чечевицы. Впервые получены  штамм-продуценты, позволяющие экспрессировать гибридные белки, содержащие искомые антимикробные пептиды. Впервые разработаны способы получения, методики выделения и очистки  рекомбинантных ареницина, аурелина, буфорина, дефенсина и липид-транспортирующего белка чечевицы,  полностью идентичных  природным пептидным антибиотикам по молекулярной массе, аминокислотной последовательности и антимикробной активности.

3. Впервые разработаны биотехнологические способы получения аналогов ареницина, аурелина, зервамицина, антиамебина, дефенсина и липид-транспортирующего белка чечевицы, меченных стабильными изотопами.

4. Впервые проанализированы структурные особенности выделенных антимикробных пептидов и спектр их биологического действия в сравнении с другими представителями этого класса биологически активных веществ. Впервые изучены физико-химические  свойства рекомбинантных ареницина, аурелина, дефенсина чечевицы, а также зервамицина, антиамебина и лихеницидина. С использованием полученных данных, предложены модели, описывающие механизмы антимикробной активности ряда исследованных пептидных антибиотиков.

Полученные сведения обогащают наши знания о защитных пептидах как природных молекулярных факторах врожденного иммунитета и могут стать основой для дальнейших исследований механизмов биологической активности этих веществ, а также могут представлять ценность для исследований в области молекулярной эволюции АМП.

Практическая ценность работы.

Полученные в ходе выполнения данной работы АМП могут представлять большой практический интерес в качестве антибиотиков нового типа. По своей антимикробной активности ряд полученных  пептидов не уступают лучшим мировым аналогам. Широкому применению АМП в клинической практике препятствует высокая себестоимость их производства. Проблема может быть успешно решена методами биотехнологии, применение которых является значительно более экономически оправданным по сравнению с химическим синтезом. Полученные в ходе данной работы новые АМП могут быть также использованы для решения задач сельскохозяйственной биотехнологии по повышению устойчивости растительных культур по отношению к микробным, в особенности грибковым патогенам. 

Апробация работы

Результаты исследований были представлены на IV, VI и VIII Гордоновских международных  конференциях по антимикробным пептидам (Gordon Research Conferences “Antimicrobial peptides”, Барга, Италия, 2003, 2007, 2011), 33-м и 36-м Конгрессах ФЕБО (Афины, Греция, 2008 и Турин, Италия, 2011),  XVIII Международном конгрессе по биохимии и молекулярной биологии (Бирмингем, Великобритания, 2000), Международной конференции “Peptaibols: Biosynthesis, Structural Diversity and Mode of Action” (Йена, Германия, 2002),  Международных конференциях по магнитному резонансу “EUROMAR-2009” и “EUROMAR-2010” (Гётеборг, Швеция, 2009 и Флоренция, Италия, 2010),  Международном симпозиуме «Nuclear magnetic resonance in condensed matter. The 4th meeting «NMR in life sciences» (Санкт-Петербург,  2007), российско-шведской конференции “NMR in Protein-Protein and Protein-DNA Recognition” (Москва, 2000),  XI и XII международных конференциях “New information technology in medicine, biology, pharmacology, and ecology” (Гурзуф, Украина, 2003, 2004), IV, V и VI Московских международных конгрессах "Биотехнология: состояние и перспективы развития»  (Москва, 2007, 2009, 2011), Международной конференции по биоорганической химии, биотехнологии и бионанотехнологии, посвященной 75-летию со дня рождения академика Ю.А.Овчинникова (Москва, 2009), Международной научно-практической конференции «Биотехнология. Вода и пищевые продукты» (Москва, 2008), Международной конференции «Scenarios for a coordinated approach to sustainable cooperation with the Eastern neighbors of the EU” (Москва, 2007),  Международной конференции по физико-химической биологии, посвященной 70-летию со дня рождения академика Ю.А.Овчинникова (Москва, 2004),  Международной конференции «Фармацевическая биоэтика» (Москва, 1997),  рабочих совещаниях участников международного проекта INTAS (Санкт-Петербург, 2005; Триест, Италия, 2006), симпозиуме «Результаты фундаментальных и прикладных исследований для создания новых лекарственных средств» (Москва, 2008), III съезде Биохимического общества России (Санкт-Петербург, 2002),  III съезде Общества биотехнологов России (Москва, 2005),  Объединенном иммунологическом форуме (Екатеринбург, 2004), III Российском симпозиуме «Белки и пептиды» (Пущино, 2007), итоговых конференциях по результатам выполнения мероприятий в рамках приоритетного направления «Живые системы» ФЦП «Исследования и разработки по приоритетным направлениям развития научно-технологического комплекса России на 2007-2012 годы» (Москва, 2007, 2008, 2009), VIII чтениях, посвященных памяти академика Ю.А. Овчинникова (Москва, 2006), 50-й научной конференции МФТИ (Москва-Долгопрудный, 2007),  научных конференциях ФИБХ РАН (Пущино, 1999, 2004),  школе-конференции «Горизонты физико-химической биологии» (Пущино, 2000), XV-XXIII  зимних молодежных научных школах «Перспективные направления физико-химической биологии и биотехнологии» (Москва, 2003-2011).

Публикации и патенты

По теме диссертации опубликовано 139 работ,  в том числе  46 статей в ведущих отечественных  и зарубежных рецензируемых журналах, из них 15 статей в российских журналах (Биоорганическая химия, Биотехнология, Биохимия, Доклады Академии наук и др.), 28 статей  в зарубежных журналах (Anal. Bioanal. Chem., Appl. Magn. Res., BBA, Biochem. Biophys. Res. Commun., Biochemistry (USA), Bioorganic Chemistry (USA),  Biochem. J., Biophys. J., Biopolymers, Chemistry & Biodiversity, FEBS Letters, J. Am. Chem. Soc., J. Biol. Chem., J. Biomol. NMR, J. Peptide Sci., Protein Pept. Letters, Proteomics и др.)  и 3 статьи в сборниках научных работ. По результатам исследований получено 9 патентов на изобретение РФ, подано 2 заявки на выдачу патента РФ. В 2009 г. патент на изобретение РФ №2316595 «Способ получения антимикробного пептида ареницина» вошёл в число 100 лучших изобретений России и получил диплом  Федеральной службы по интеллектуальной собственности, патентам и товарным знакам. По теме работы опубликовано также 82 тезиса докладов, в том числе 43 тезиса на международных конференциях и 39 тезисов  на российских конференциях.

Личный вклад автора.

Автору принадлежит решающая роль в выборе направления и объектов исследований, разработке и проверке предложенных в работе экспериментальных подходов на всех этапах работ по выделению, изучению структуры,  биотехнологическому получению аналогов и исследованию биологической активности  природных пептидных антибиотиков -  от постановки задачи и планирования экспериментов до анализа, обсуждения, обобщения  и оформления полученных результатов. Весь экспериментальный материал получен при непосредственном участии автора и под его научным руководством, за исключением физико-химических исследований, выполненых в лаборатории биомолекулярной ЯМР-спектроскопии ИБХ РАН. 

СОДЕРЖАНИЕ РАБОТЫ

1. Исследование новых антимикробных пептидов ареницинов из целомоцитов морского кольчатого червя Arenicola marina

1.1. Определение первичной структуры ареницинов. Определение полных последовательностей кДНК, кодирующих предшественники ареницинов, и соответствующих им полных аминокислотных последовательностей препроареницинов.

Ареницины были выделены из целомоцитов морского кольчатого червя пескожила Arenicola marina, который принадлежит к семейству Arenicolidae, отряду Drilomorpha, классу Polychaeta, типу Annelida, с помощью препаративного гель-электрофореза и обращенно-фазовой ВЭЖХ  и предоставлены  для исследований лабораторией общей патологии Института экспериментальной медицины РАМН (рук. д.б.н. В.Н.Кокряков).

С помощью масс-спектрометрического анализа на масс-спектрометре VISION 2000 (ThermoBioAnalysis) нами были выявлены две изоформы пептида, названные ареницином-1 и ареницином-2 и имеющие молекулярные массы 2758,3 Да и 2772,3 Да, соответственно, и установлены их первичные структуры.  Одной из характеристик, положенных в основу современной классификации антимикробных пептидов, является наличие в их структуре внутримолекулярных дисульфидных связей, играющих важную роль в формировании и поддержании их пространственной структуры. Определение числа остатков цистеина проводилось путем их химической модификации с помощью 4-винилпиридина. Ареницины подвергали денатурации в гуанидинхлориде, после чего дисульфидные связи восстанавливали дитиотреитолом с последующим алкилированием 4-винилпиридином с образованием стабильных производных цистеина - S-пиридилэтилцистеинов. Масс-спектрометрический анализ полученных производных выявил молекулярные ионы с m/z 2970,3 для S-пиридилэтилированного ареницина-1 и m/z 2984,7 для S-пиридилэтилированного ареницина-2, что соответствует возрастанию молекулярной массы каждого пептида на 212 Да после модификации и свидетельствует о наличии в каждом пептиде двух остатков цистеина, образующих одну дисульфидную связь.

Для определения N-концевой аминокислотной последовательности выделенных антибиотиков применяли автоматическое микросеквенирование на приборе Procise 491 cLC Protein Sequencing System (Applied Biosystems, США). Идентификацию фенилтиогидантоин-производных аминокислот проводили на анализаторе 120A PTH Analyzer (Applied Biosystems, США). В результате автоматического микросеквенирования ареницинов и их S-пиридилэтилированных производных были установлены частичные (95%) аминокислотные последовательности обеих изоформ ареницина, включая  локализацию остатка цистина. 

Для установления полной первичной структуры предшественников ареницинов была выделена суммарная РНК из целомоцитов Arenicola marina с использованием колонки Spin (Promega, США). Определение структуры генов, кодирующих ареницины, проводили путем обратной транскрипции и амплификации с помощью набора реактивов SMART* RACE** cDNA Amplification Kit (Clontech; *SMART -  Switching Mechanism at 5’ end of RNA Transcript; **RACE – Rapid Amplification of cDNA Ends). RACE представляет собой метод быстрой амплификации концевых последовательностей кДНК с помощью полимеразной цепной реакции. Методом RACE были амплифицированы сначала 3’-концевые, а затем 5’-концевые области транскриптов, кодирующих ареницины. Структуры ген-специфических праймеров для 3’-RACE выбирались на основании данных по аминокислотной последовательности зрелых пептидов с учетом вырожденности генетического кода и данных по частоте использования кодонов у Arenicola  marina и филогенетически близких организмов. Продукты ПЦР были клонированы и просеквенированы. Анализ установленной нуклеотидной последовательности позволил определить полную первичную структуру предшественников ареницинов.

Структура полноразмерной кДНК (около 1300 п.о.) предшественника ареницина-1 была получена путем сопоставления результатов секвенирования 3’-  и 5’-концевых фрагментов (рис. 1). Структуры кДНК были зарегистрированы в банке данных GenBank под номерами AY684856 и AY684857.

В обоих случаях анализ нуклеотидной последовательности показал наличие открытой рамки считывания, кодирующей предшественник ареницина размером 202 аминокислотных остатка (регистрационные номера в банке данных SwissProt – Q5SC60 и Q5SC59). Участок, соответствующий зрелому пептиду (21 аминокислотный остаток), расположен в С-концевой области предшественника.

С помощью компьютерного анализа с использованием алгоритма SignalP 3.0 (http://www.cbs.dtu.dk/services/SignalP/) выявлена вероятная N-концевая сигнальная последовательность белка (25 аминокислотных остатков), необходимая для его транспортировки в эндоплазматический ретикулум. Длина фрагмента между сигнальным и зрелым пептидами составила 156 аминокислотных остатков. На границе между продоменом и зрелым пептидом выявлен дипептид из катионных остатков (Lys-Arg), что указывает на возможное участие протеиназы из семейства фурина в процессинге проареницинов.

       При сравнении кДНК двух изоформ ареницина были обнаружены нуклеотидные замены, в отдельных случаях приводящие к аминокислотным заменам (рис. 2). Секвенирование клонов, содержащих 5’-концевые области кДНК, показало, что некоторые из них кодируют цистеин в положении 10 сигнального пептида, в то время как другие, включая клон, содержащий последовательность ареницина-2, кодируют тирозин. Наблюдаемая замена может свидетельствовать о наличии двух различных копий гена ареницина-1 в геноме Arenicola marina.

Зрелые ареницин-1 и ареницин-2 содержат по 21 аминокислотному остатку каждый и имеют расчетные молекулярные массы 2758,3 Да и 2772,3 Да, совпадение которых с экспериментальными значениями масс молекулярных ионов говорит об отсутствии посттрансляционных модификаций у этих пептидов.

         С  50

препроареницин-1        MTSTQSVAVYATLILAIFCVNDIHCDPIAEARAAAFGEREARSDGEWKQF

препроареницин-2        MTSTQSVAVYATLILAIFCFNDIHCDPIAEARAAAFGEREARSAGEWKQF

                        51                                                                 100

                               DVNGEKIEVNEQENREIIRQAGGDGVEGSVMVIDHAKGLISWSIPRAGEC

                               DVNGEKVEVNEQENREIIRQAGGDGVEGSVMVIDHAKGLIIWSIPRAGEC

                         101                                                                 150

                               YLIGGVDKQLPDAQELLHYFQSAQGSADGEGVESALDYVKAEDRPVTDLN

                               YLIGGVDKQLPDAQELLHYFRSAQGSADGEGVQSALDYVKAEDRPVTDLN

                         151                                                                 202

                               LLAPEVREACQGKSVYWLEKSSGDNNEPEKRRWCVYAYVRVRGVLVRYRRCW

                               LLAPEVREACQGKSVYWLEKSSGDNNEPEKRRWCVYAYVRIRGVLVRYRRCW

Рис. 2. Сравнение аминокислотных последовательностей предшественников ареницина-1 и ареницина-2. Темно-серым цветом выделен сигнальный пептид, светло-серым – продомен, черным – зрелый пептид. В рамки заключены аминокислотные замены. Один из вариантов препроареницина-1 содержит остаток цистеина в положении 10 сигнального пептида.

C-Концевая карбоксильная группа ареницинов не амидирована; данная модификация возможна лишь при наличии в структуре предшественника остатка глицина, следующего непосредственно за концевым остатком зрелого пептида. Более половины остатков, входящих в состав зрелых ареницинов, имеют ярко выраженные гидрофобные свойства. Катионный характер молекулы обусловлен присутствием 6 остатков аргинина. Установленная аминокислотная последовательность не имеет гомологии с известными представителями этой группы молекул. Уникальная особенность ареницинов состоит в формировании ими больших 18-членных циклов, замкнутых дисульфидной связью.

Размеры продомена препроареницинов значительно превышают длину соответствующих участков, встречающихся в предшественниках других АМП. Поиск в базах данных по аминокислотным и нуклеотидным последовательностям (http://www.ncbi.nlm.nih.gov/BLAST) позволил обнаружить сходство продомена предшественника ареницина с продоменами предшественников хондромодулинов – факторов роста и дифференцировки хрящевой ткани и ингибиторов ангиогенеза у различных видов позвоночных. Степень гомологии достигает 25% идентичных или 46% эквивалентных остатков. При этом для выравнивания последовательностей длиной около 130 аминокислотных остатков достаточно введения всего нескольких разрывов (рис. 3). С помощью анализа, основанного на сравнении установленной последовательности с моделями Маркова, построенными для известных консервативных доменов (http://smart.embl-heidelberg.de), была выявлена  принадлежность препроареницинов к группе белков, содержащих домен BRICHOS, идентифицированный в ряде функционально несвязанных друг с другом белков человека, ассоциированных с различными заболеваниями. К ним относятся  хондромодулины, участвующие в патогенезе хондросаркомы, белки семейства BRI, мутации которых наблюдаются при наследственной деменции,  гастрокин-1 (белок CA11), пониженная экспрессия которого отмечается при раке желудка, сурфактантный белок SP-C, снижение уровня экспрессии которого сопряжено с расстройствами дыхательной системы. На сегодняшний день домен BRICHOS обнаружен в 12 различных семействах белков. О древнем происхождении домена BRICHOS свидетельствует наличие гомологичных ему участков в  геномных последовательностях иглокожих, круглых червей, насекомых и ланцетников. Кроме того, наблюдается сходство в механизмах процессинга этих белков. Большинство из них являются секретируемыми белками, расщепляемыми по сайту  из сдвоенных катионных остатков и несущим склонный к агрегации С-концевой фрагмент, стабилизированный дисульфидной связью. Ранее было высказано предположение о том, что домен BRICHOS участвует в процессинге содержащих его белков. В настоящее время появились данные об участии домена BRICHOS в процессе биосинтеза ряда -структурных пептидов и белков в качестве шаперона, предотвращающего образование амилоидных структур.

Определенная нами полная структура зрелых ареницинов и генов их предшественников позволяет сделать вывод о выявлении нами оригинальных пептидов, не принадлежащих ни к одному из известных ранее классов антимикробных пептидов эндогенного происхождения. Заявляемые пептиды принадлежат к новому структурному классу пептидных антибиотиков, что послужило основанием для получения патента на изобретение Российской Федерации. Ареницины содержат 21 аминокислотный остаток и одну дисульфидную связь,  формирующую цикл, состоящий из 18 аминокислотных остатков.

1.2. Гетерологичная экспрессия и очистка ареницина-2.

В ходе выполнения данной работы создана патентно чистая технология гетерологичной экспрессии ареницинов. Получены патенты на изобретение «Рекомбинантная плазмидная ДНК pE-His8-TrxL-Ar2, кодирующая гибридный белок, содержащий антимикробный пептид ареницин морского кольчатого червя Arenicola marina, и штамм Escherichia coli BL21(DE3)/pE-His8-TrxL-Ar2 - продуцент гибридного белка, содержащего ареницин» и «Способ получения антимикробного пептида ареницина». Первое изобретение позволило решить задачу конструирования плазмиды для получения ареницина в составе гибридного белка, а также задачу  создания высокопродуктивного штамма-продуцента данного гибридного белка. Поставленная задача была решена за счет конструирования рекомбинантной плазмидной ДНК pE-His8-TrxL-Ar2 размером 4059 п.о., кодирующей гибридный белок His8-TrxL-Ar2, содержащий гистидиновый октамер, модифицированный тиоредоксин А (M37L) и искомый антимикробный пептид ареницин (рис. 4),  а также за счет создания штамма Escherichia coli BL21(DE3)/pE-His8-TrxL-Ar2 – продуцента гибридного белка, содержащего антимикробный пептид ареницин. Введение остатка метионина непосредственно перед N концевым остатком рекомбинантного ареницина обеспечило возможность избирательного химического расщепления полипептидной цепи бромцианом с высвобождением  целевого пептида,  не содержащего  каких-либо дополнительных

аминокислотных остатков по сравнению с природным ареницином. Использование тиоредоксина А в качестве партнера для рекомбинантной экспрессии позволило нейтрализовать токсичность антимикробного пептида для штамма-продуцента и благодаря этому достичь высоких выходов гибридного белка. Преимущество замены лейцином остатка метионина в положении 37 природного тиоредоксина А, а также использования плазмиды pET20b(+) в качестве основы для создания pE-His8-TrxL-Ar2 состоит в уменьшении числа фрагментов, получаемых в результате расщепления гибридного белка бромцианом. Расщепление гибридного белка His8-TrxL-Ar2 бромцианом  привело к образованию  всего одного побочного продукта, значительно отличающегося по молекулярной массе и физико-химическим свойствам от целевого пептида, что облегчило его выделение. Наличие гистидинового октамера в N-концевом участке экспрессируемой последовательности обеспечило возможность аффинной очистки гибридного белка His8-TrxL-Ar2 методом металло-хелатной хроматографии. Для биосинтеза рекомбинантного белка применялись оптимальные регуляторные элементы, контролирующие его экспрессию. Конструирование нового гена, кодирующего гибридный белок His8-TrxL-Ar2, осуществляли на основе плазмиды pET20b(+). Искусственный ген, кодирующий гистидиновый октамер, модифицированный тиоредоксин А (M37L) и ареницин, фланкированный сайтами рестриктаз BglII и XhoI, был получен  химическим синтезом набора олигонуклеотидных фрагментов с последующей их сборкой и амплификацией при помощи полимеразной цепной реакции (ПЦР). Перед лигированием для получения липких концов продукт амплификации и векторную плазмиду обрабатывали  рестриктазами BglII и XhoI. Лигазную смесь использовали для трансформации компетентных клеток E.coli DH10B.

Отбор положительных клонов проводили при помощи ПЦР с использованием специфических праймеров и последующим рестриктным анализом выделенной плазмидной ДНК. Структуру гена, кодирующего гибридный белок, содержащий ареницин, определяли  секвенированием по методу Сэнгера. Для получения штамма-продуцента гибридного белка His8-TrxL-Ar2 препаратом плазмидной ДНК pE-His8-TrxL-Ar2 трансформировали компетентные клетки E. coli BL21(DE3) и проводили отбор клонов, обладающих способностью экспрессировать рекомбинантный белок. Преимущества запатентованного штамма E.coli BL21(DE3) заключаются в использовании бактерий с фенотипом Lon OmpT, что исключает возможность протеолитического расщепления синтезируемого de novo рекомбинантного белка и загрязнения препарата наиболее активными протеазами E. coli. У ровень экспрессии рекомбинантных белков контролировали с помощью электрофореза в полиакриамидном геле. Было показано, что клетки E.coli BL21(DE3)/pE-His8-TrxL-Ar2 являются суперпродуцентом ареницина. При индукции изопропилтио--D-галактозидом происходит эффективный биосинтез гибридного белка His8-TrxL-Ar2, содержащего ареницин, который накапливается в клетках в количестве 20–25% от суммарного белка бактерии. Задача получения рекомбинантного ареницина, полностью идентичного природному пептиду, была решена путем  культивирования штамма-продуцента,  индукции синтеза рекомбинантного белка, разрушения клеток, отделения нерастворимой фракции клеточного белка, очистки гибридного белка His8-TrxL-Ar2 с помощью металло-хелатной хроматографии, его солюбилизации и расщепления бромцианом в кислой среде по остатку метионина, разделения продуктов реакции и окончательной очистки ареницина методом обращенно-фазовой ВЭЖХ. Увеличение выхода рекомбинантного белка было  достигнуто с помощью принудительной аэрации культуральной жидкости и использования обогащенных питательных сред (с добавлением глюкозы). Идентичность рекомбинантного ареницина природному пептиду устанавливали  методами электрофореза в полиакриамидном геле, масс-спектрометрии, автоматическим секвенированием N-концевой аминокислотной последовательности по методу Эдмана. Выход продукта составил около 5 мг/л культуры.

1.3. Антимикробная активность ареницина.

Антимикробная активность природного и рекомбинантного ареницина определялась методом радиальной диффузии пептидов в агарозном геле с тест-культурой микроорганизма и методом двукратных серийных разведений антибиотика в жидкой питательной среде LB. Для определения антимикробной активности использовали культуры следующих микроорганизмов: грам-отрицательные бактерии Escherichia coli ML-35p и Agrobacterium tumefaciens A281; грам-положительные бактерии  Listeria monoсytogenes EGD, Staphylococcus aureus 209p, Bacillus megaterium VKM41, Micrococcus luteus B1314, устойчивый к метициллину штамм Staphylococcus aureus ATCC 33591 (MRSA),  дрожжеподобный низший гриб Candida albicans 820; фитопатогенные грибы класса аскомицетов  Fusarium solani VKM F-142, Fusarium oxysporum ТСХА-4, Alternaria alternata VKM F-3047, Aspergillus niger VKM F-2259, Aspergillus versicolor VKM F-1114,  Neurospora crassa VKM F-184. Результаты тестирования представлены в таблице 1. Минимальные ингибирующие концентрации (МИК) определяли в трёх независимых экспериментах. МИК природного и рекомбинантного ареницинов достоверно не различаются. Показано, что генно-инженерные ареницины проявляют микробицидную активность в отношение всех иссследованных тест-микроорганизмов. Установлено, что данные пептиды обладают широким спектром антимикробного действия и эффективно ингибируют рост грам-положительных и грам-отрицательных бактерий, а также дрожжеподобных и фитопатогенных грибов. Ареницины имеют сходную, а в некоторых случаях и более высокую антибактериальную активность по сравнению с одним из наиболее хорошо изученных антимикробных пептидов - протегрином 1. Наибольшей активностью ареницины обладают в отношение грам-положительных бактерий, и МИК для таких культур, как Listeria monocytogenes EGD, Bacillus megaterium VKM41 и Micrococcus luteus B1314 находится в диапазоне концентраций 0,6-2,6 мкг/мл. Наиболее чувствительной к данным антибиотикам грам-положительной культурой является Listeria monocytogenes EGD. Ареницины также эффективно подавляют рост грам-отрицательных бактерий Escherichia coli ML-35p и Agrobacterium tumefaciens 281, а также дрожжеподобного гриба Candida albicans 820. МИК для этих культур не превышает 5 мкг/мл. Ареницины ингибируют прорастание спор и созревание всех исследованных фитопатогенных грибов. Наиболее чувствительными к ареницинам грибковыми культурами являются Neurospora crassa VKM F-184, Aspergillus versicolor VKM F-1114 и Botrytis cinerea VKM F-85. Для этих культур МИК составляет не более 25 мкг/мл. Менее чувствительным к ареницинам фитопатогеном являются Fusarium solani VKM F-142, для которого МИК не превышает 50 мкг/мл. Наиболее устойчивыми к действию тестируемых антибиотиков являются Alternaria alternata VKM F-3047, Aspergillus niger VKM F-2259 и Fusarium oxysporum ТСХА-4, для которых МИК90 составляет 100 и более мкг/мл. Необходимо отметить, что сравнение противогрибковой активности ареницинов показывает, что ареницин-более эффективно, чем ареницин-2, подавляет рост Fusarium oxysporum и Aspergillus versicolor. В тоже время, для ингибирования роста Neurospora crassa и Fusarium solani требуются меньшие концентрации ареницина-2.

Таблица 1. Антимикробная активность природного и рекомбинантного ареницина.

Тест-культуры

Ар-2 природный

Ар-2 рекомбинантный

 

МИК  (мкг/мл)*

Грам-положительные бактерии

Listeria monocytogenes EGD

0,6

0,6

Staphylococcus aureus АTTC 33591 (MRSA)

н.о.

2,6

Bacillus megaterium VKM41

н.о.

2,6

Micrococcus luteus B1314

н.о.

2,6

Грам-отрицательные бактерии

Escherichia coli ML-35p

4,0

4,0

Agrobacterium tumefaciens A281

н.о.

5,0

Грибы

Candida albicans 820

4,5

4,5

Alternaria alternata VKM F-2259

н.о.

100,0

Botrytis cirenea VKM F-85

н.о.

12,5

Neurospora crassa VKM F-184

н.о.

12,5

Fusarium oxysporum ТСХА-4

н.о.

100,0

Fusarium solani VKM F-142

н.о.

25,0

Aspergillus versicolor VKM F-1114

н.о.

25,0

Aspergillus niger VKM F-2259

н.о.

100,0

1.4. Биотехнологическое получение аналогов ареницина, меченных стабильными изотопами 13C и 15N.

Экспрессия меченых аналогов ареницина проводилась с использованием штамма E.coli BL21(DE3), трансформированного плазмидой pET-His8-TrxL-Ar2. Для наработки плазмидной ДНК использовался штамм E. coli DH-10B (RecA–). Полученными препаратами плазмиды были трансформированы компетентные клетки E. coli BL21 (DE3), приготовленные стандартным кальциевым методом. Трансформанты выращивались на чашках с агаризованной средой LB, содержащей ампициллин. Для подавления базальной экспрессии гибридного белка в питательную среду добавлялось 0,5% глюкозы. Клетки клонов, отобранных для экспрессии, выращивались в 100 мл жидкой среды LB, содержащей 100 мкг/мл ампициллина и 0,5% глюкозы при 37С и 250 rpm в течение 16 ч. По окончании инкубации оптическая плотность клеточной культуры OD600 составляла 2,0-3,0 ед. Клеточную массу собирали центрифугированием при 2000 rpm и трижды отмывали физиологическим раствором NaCl от остатков богатой питательной среды. Для препаративной экспрессии ареницина, меченного стабильными изотопами, полученной клеточной массой засевали 1–2 л бедной питательной среды M9, включающей 13C6-меченую глюкозу и/или 15N-меченый  хлорид аммония. Экспрессия проводилась при температуре 30С и индукции ИПТГ в концентрации 0,2-0,5 мМ в течение 18 ч. Клеточный осадок получали центрифугированием, после чего клетки ресуспендировали  и подвергали обработке ультразвуком. Нерастворимую фракцию клеточного белка (тельца включения) отделяли центрифугированием. Осадок растворяли в фосфатном буфере (pH 7,7), содержащем 6М гуанидин-гидрохлорид  и 10 мМ имидазола. Раствор подвергали металло-хелатной очистке на Ni-NTA агарозе в указанном буфере, элюируя белок повышением концентрации имидазола до 500 мМ. Компоненты буфера удаляли с помощью диализа против воды через мембрану с размером пор 14 кДа. Выпавший в осадок гибридный белок высушивали, взвешивали и перерастворяли в 80% растворе ТФУ в концентрации 5%. Целевой пептид получали в результате расщепления гибридного белка бромцианом при 100-кратном молярном избытке последнего в течение 16 ч. Летучие компоненты реакционной смеси удаляли путем упаривания в вакууме. Тонкая очистка ареницина осуществлялась с помощью обращенно-фазовой ВЭЖХ в градиенте концентрации ацетонитрила. Идентификацию целевых  пептидов и оценку чистоты полученных препаратов проводили с помощью электрофореза в полиакриламидном геле и MALDI-TOF масс-спектрометрии. Полученные экспериментально значения молекулярных масс 15N-меченого и 13C,15N-меченого ареницина-2 с высокой точностью совпадали с расчетными, составляющими 2812,5 и 2939,5 Да, соответственно. 15N- и 13C,15N-Меченые аналоги ареницина-2 были охарактеризованы методом ЯМР-спектроскопии. Было установлено, что препараты имеют высокую степень обогащения стабильными изотопами (более 98% для 15N и более 95% для 13С). Разработанная  схема гетерологичной экспрессии и очистки аналогов ареницина, меченных стабильными изотопами, позволила получить достаточные количества этих пептидов для проведения их дальнейших исследований методом ЯМР-спектроскопии. Использование изотопно-меченых аналогов ареницина позволило детально исследовать динамику основной и боковых цепей пептида в водном окружении.

1.5. Исследование физико-химических  свойств ареницина.

Физико-химическое исследование ареницина проводилось в лаборатории биомолекулярной ЯМР-спектроскопии ИБХ РАН (с.н.с. З.О.Шенкарёв, рук. лаб. проф. А.С.Арсеньев). Используя рекомбинантные аналоги ареницина, методами ЯМР-спектроскопии была определена пространственная структура ареницина-2 в водном растворе (рис. 5). Было показано, что молекула ареницина-2 представляет собой протяженную -шпильку, на конце которой находится -поворот I’ типа (остатки Ile10-Val13). Методами 1H,13C,15N-ЯМР-спектроскопии была исследована пространственная структура ареницина в растворе мицелл DPC, моделирующих мембранное окружение. Показано, что пептид формирует параллельные симметричные димеры путем ассоциации N-концевых -тяжей (CNNC) (рис. 6). Установлено, что пептид при взаимодействии с мицеллой DPC и димеризации  сохраняет структуру -шпильки, однако ее скрученность значительно уменьшается и тип -поворота изменяется с I’ на IV.

Рис. 5. Пространственная структура ареницина-2 в водном растворе.

Рис. 6. Пространственная структура димера ареницина в растворе мицелл DPC.

Методом КД-спектроскопии также было показано, что при связывании с поверхностью мицелл детергентов (DPC, SDS) происходит изменение конформации пептида. Используя метод КД-спектроскопии, было проведено исследование взаимодействия ареницина-2 с липидными везикулами различного состава. Для исследования были использованы как нейтральные моноламелярные липосомы (POPC), моделирующие мембраны эукариотических клеток, так и отрицательно заряженные липосомы (POPE/POPG), моделирующие мембраны бактериальных клеток. Было установлено, что ареницин-2 эффективно взаимодействует с заряженными мембранами, но практически не взаимодействует с нейтральными мембранами.

Полученные данные позволяют объяснить специфичность антимикробного действия ареницинов и дают основания для предположения, что основной мишенью для действия этих пептидов является клеточная мембрана.

1.6. Модель антибиотического действия ареницина. 

На основании полученных результатов совместно с лабораторией биомолекулярной ЯМР-спектроскопии предложена модель действия пептида, в рамках которой антибиотическое действие ареницина опосредовано образованием олигомерных -структурных пор в мембране клетки-мишени. Согласно предложенной модели механизм действия пептида включает несколько этапов.

  1. Молекулы ареницина, несущие положительный заряд (+6), в конформации скрученной бета-шпильки приближаются к поверхности мембраны клетки. При присоединении пептида к поверхности мембраны происходит значительное  уменьшение скрученности бета-шпильки пептида с образованием димеров.
  2. Димеры пептида претерпевают дальнейшую олигомеризацию на поверхности мембраны клетки с участием отрицательно заряженных липидных головок. Образуется так называемая «ковровая» структура. При увеличении концентрации пептидов в наружном монослое мембраны часть пептидов переходит в трансмембранное положение (длина бета-шпильки ареницина > 30 ангстрем).
  3. Трансмембранные олигомеры ареницина образуют пептид-липидные («тороидальные») поры в мембране. В образовании каждой поры участвуют как димеры пептида, так и головки отрицательно заряженных липидов, встроенные между ними. Полярные группы боковых цепей ареницина и головки липидов выстилают внутренность поры, а гидрофобные участки димеров контактируют с липидными хвостами окружающей мембраны. Образование «тороидальных» пор ведет к лизису и гибели бактериальной клетки.

2. Исследование антимикробного пептида аурелина из мезоглеи сцифоидной медузы Aurelia aurita.

2.1. Определение первичной структуры аурелина. Определение полной последовательности кДНК, кодирующей предшественник аурелина, и соответствующей ей полной аминокислотной последовательности препроаурелина.

Новый антимикробный пептид аурелин с молекулярной массой 4296,95 Да был выделен из мезоглеи медузы Aurelia aurita [тип – кишечнополостные (Cnidaria), класс – сцифоидные (Scyphozoa)] с помощью препаративного гель-электрофореза и обращенно-фазовой ВЭЖХ и предоставлен для исследований лабораторией общей патологии Института экспериментальной медицины РАМН (рук. д.б.н. В.Н.Крокряков). 

Определение числа остатков цистеина проводилось путем их химической модификации с помощью 4-винилпиридина по методике, описанной в разделе 1.1. Масс-спектрометрический анализ полученного S-пиридилэтилированного производного аурелина выявил молекулярный ион с m/z 4926,15, соответствующим возрастанию молекулярной  массы на 629,2 Да, что  свидетельствует о наличии в аурелине шести остатков цистеина, образующих 3  дисульфидных связи. Для определения N-концевой аминокислотной последовательности аруелина применяли автоматическое микросеквенирование на приборе Procise 491 cLC Protein Sequencing System (Applied Biosystems, США). Идентификацию фенилтиогидантоин-производных аминокислот проводили на анализаторе 120A PTH Analyzer (Applied Biosystems, США). В результате автоматического микросеквенирования аурелина и его S-пиридилэтилированного производного была установлена его частичная  аминокислотная последовательность (35 остатков), включая локализацую остатков цистеина. 

Для установления полной первичной структуры предшественника аурелина была выделена суммарная РНК из мезоглеи  медузы Aurelia aurita с использованием колонки Spin (Promega, США). Амплификация 3’-концевого участка кДНК аурелина по указанной выше методике не позволяла получить искомый фрагмент в одну стадию ОТ-ПЦР. Вероятной причиной этого послужило низкое содержание соответствующей мРНК в тканях медузы. Продукты RACE были успешно реамплифицированы с внутренними ген-специфическими праймерами (semi-nested PCR). Секвенирование клонированных фрагментов длиной около 300 п.о. показало, что они содержали последовательность, кодирующую C-концевую область зрелого аурелина, и область 3’-UTR.

Дальнейшие эксперименты по амплификации и секвенированию 5’-концевой области кДНК позволили установить полную структуру транскрипта длиной около 500 п.о. (рис. 7). Анализ нуклеотидной последовательности показал наличие открытой рамки считывания, кодирующей предшественник антимикробного пептида аурелина, состоящий из 84 аминокислотных остатков. Зрелый пептид длиной 40 аминокислотных остатков локализован в C-концевой области предшественника непосредственно за последовательностью Arg-Ser-Arg-Arg, представляющей собой типичный сайт протеолиза для конвертаз семейства фурина. С помощью программы SignalP 3.0 была обнаружена вероятная N-концевая сигнальная последовательность, отщепляемая при гидролизе связи Ala22 – Glu23.

Результаты секвенирования нуклеотидной последовательности кДНК подтвердили наличие в структуре пептида шести остатков цистеина. Уникальный порядок расположения остатков цистеина в аурелине отличает его как от дефенсинов, так и от всех других семейств цистеин-содержащих АМП (табл. 2). Его ближайшими гомологами в настоящее время можно считать группу токсинов из яда морских анемон (класс Anthozoa, тип Coelenterata), блокирующих калий-селективные каналы нервных клеток. Перечень структур, гомологичных аурелину, не ограничивается токсинами морских анемон. Близкий по структуре гексацистеиновый мотив с неизвестной функцией, обозначаемый в разных источниках как домен NC6, SXC, Tox1 или ShKT, был идентифицирован в ряде белков позвоночных и беспозвоночных животных. Мотив присутствует главным образом в секретируемых муцин-подобных гликопротеинах и ферментах (астацин-подобных металлопротеиназах, тирозиназах, миелопероксидазах).

Детальный анализ последовательности аурелина показал наличие в ней консервативных остатков, играющих ключевую роль в функционировании ShK-подобных токсинов. Способность токсинов с принципиально различающейся укладкой цепи избирательно блокировать ионные каналы одного и того же типа зависит от присутствия и пространственного расположения ограниченного набора молекулярных детерминант. Сканирование аланином последовательностей ShK и BgK  позволило определить сайты связывания этих токсинов с потенциал-зависимыми калиевыми каналами и показало, что доминирующий вклад в это взаимодействие вносит функциональная диада Lys-Tyr, расположенная на участке C4–C5. В структуре аурелина сохраняется главный компонент диады – Lys, однако в роли его партнера выступает не Tyr, а остаток Leu (рис. 8). Похожая картина наблюдается и у метридина, токсина из анемоны Metridium senile, в молекуле которого функцию второго остатка выполняет Val. Известно, что аминокислотная замена Tyr/Leu в диаде не приводит к потере блокирующей активности токсинов.

       

Перечень структур, гомологичных аурелину, не ограничивается токсинами морских анемон. Близкий по структуре гексацистеиновый мотив, обозначаемый в разных источниках как домен NC6, SXC, Tox1 или ShKT, был идентифицирован в ряде белков беспозвоночных и позвоночных животных. Мотив присутствует главным образом в секретируемых муцин-подобных гликопротеинах и ферментах (астацин-подобных металлопротеиназах, тирозиназах, миелопероксидазах). Его функция в составе крупных молекул неясна, но по аналогии с EGF-доменом  предполагается, что он может участвовать во взаимодействиях внеклеточных белков и играет роль лиганда в опосредованной мембранными рецепторами передаче сигналов внутрь клетки. Наиболее консервативной областью домена является фрагмент между C4 и C6, включающий диаду Lys-Thr непосредственно перед C5. Остаток Lys из этой диады участвует в стабилизации домена, электростатически взаимодействуя с консервативным остатком Asp, находящимся в положении  –2 относительно C1  (рис. 8).

Препроаурелин имеет типичное для предшественников многих АМП строение: вслед за сигнальным пептидом, несущим положительный заряд на N-конце, следуют анионный продомен и зрелый катионный пептид, отщепляемый по сайту из сдвоенных основных остатков (рис. 9). Сходными структурными чертами обладает предшественник HmK – единственного токсина этого семейства, последовательность кДНК которого была депонирована в GenBank. Гомология предшественников токсина HmK и аурелина наблюдается лишь в области зрелых пептидов, в то время как сходство сигнальных участков и продоменов ограничивается одинаковым распределением заряженных и гидрофобных остатков.

Структурное сходство аурелина с пептидами из морских анемон наводит на мысль о вероятной способности этого пептида блокировать ионные каналы. В настоящее время известен ряд фактов гомологии и функционального сходства АМП и пептидных токсинов. Наиболее убедительным объяснением такого сходства служит гипотеза о дивергентной эволюции этих молекул. Существование общих эволюционных предшественников у представителей именно этих классов пептидов представляется биологически целесообразным. Несмотря на разную направленность действия, условия их функционирования предъявляют сходные требования к структуре и физико-химическим свойствам. Независимо от степени эволюционного родства аурелина с нейротоксинами перспективы его использования в качестве антимикробного средства будут определятся селективностью его действия и наличием побочных эффектов, которые могут быть установлены только экспериментальным путем.

2.2 Гетерологичная экспрессия и очистка аурелина.

Штамм-продуцент гибридного белка His8-TrxL-Aur, содержащего последовательность целевого пептида аурелина, был получен путем трансформации препаратом векторной ДНК pET-His8-TrxL-Aur (рис. 10) компетентных клеток E. coli и отбора клонов, обладающих способностью экспрессировать рекомбинантный белок. В качестве родительского штамма для создания штамма-продуцента использовали E.coli BL21(DE3). Преимущество использования данного штамма в качестве основы для создания штамма-продуцента состоит в том, что BL21 (DE3) обладает фенотипом Lon OmpT, что исключает возможность протеолитического расщепления синтезируемого гибридного белка и загрязнения препарата наиболее активными протеазами E. coli. В хромосомную ДНК BL21(DE3) интегрирован ген Т7-РНК полимеразы, который совместно с Т7 промотором и Т7 терминатором в плазмиде pET-His8-TrxL-Aur обеспечивает продукцию гибридного белка клетками E. coli при индукции изопропилтио--D-галактозидом или лактозой. Базальная экспрессия (до момента добавления индуктора) Т7 РНК-полимеразы и гибридного белка His8-TrxL-Aur поддерживается на минимальном уровне благодаря наличию системы контроля на основе lac-операторов и генов lac-репрессора, присутствующих как в плазмиде pET-His8-TrxL-Aur, так и в хромосоме штамма-продуцента. продуцента. Препаратами плазмиды были трансформированы компетентные клетки E. coli BL21 (DE3), приготовленные стандартным кальциевым методом. Трансформанты выращивали при температуре 37С на чашках с агаризованной средой LB, содержащей 50 мкг/мл ампициллина. Для подавления базальной экспрессии гибридного белка в питательную среду добавляли 0,5 % глюкозы.

Препаративную экспрессию гибридного белка His8-TrxL-Aur проводили в 2 л колбах, заполненных культуральной средой на от полного объема, при температуре 30С. Индукцию осуществляли путем добавления изопропилтио--D-галактозида до концентрации 0,2 мМ. Плотность культуры (OD600) в момент добавления индуктора составляла 0,6,  конечная плотность после инкубации в течение 4,5ч – 1,8.

Рис. 10. Физическая карта рекомбинантной плазмиды pET-His8-TrxL-Aur. ColE1 origin – участок инициации репликации плазмиды; f1 origin – участок инициации репликации бактериофага f1; bla – ген устойчивости к -лактамным антибиотикам; lac I – ген lac-ингибитора; T7lac promoter – промотор транскрипции бактериофага Т7 с lac-оператором; T7 terminator – терминатор транскрипции; His8-TrxL-Aur – ген гибридного белка, содержащего аурелин.

Клеточный осадок получали центрифугированием, ресуспендировали и подвергали ультразвуковой обработке. Растворимую фракцию клеточного белка получали центрифугированием и разделяли с помощью металлохелатной хроматографии на Ni-NTA. Целевой пептид получали в результате расщепления гибридного белка бромцианом. Продукты расщепления повторно пропускали через металлохелатную колонку. Целевой пептид подвергали тонкой очистке методом обращенно-фазовой ВЭЖХ. Выход пептида в пересчете на 1л клеточной культуры составил 10мг. Идентичность рекомбинантного и природного аурелина устанавливали методами ПААГ-электрофореза в денатурирующих услових, МАЛДИ-времяпролетной масс-спектрометрии, автоматическим микросеквенированием N-концевой аминокислотной последовательности по методу Эдмана, тестированием антимикробной активности. Полученный препарат антимикробного пептида аурелина был проанализирован методом 1H-ЯМР спектроскопии. Анализ спектров ЯМР позволил установить, что пептид имеет жесткую пространственную структуру, и чистота препаратов рекомбинантного аурелина составляет не менее 98%.

2.3. Антимикробная активность аурелина.

Антимикробную активность очищенного рекомбинантного и природного пептида определяли методом радиальной диффузии пептида в агарозном геле в отношение тест-культур бактерий: Bacillus megaterium VKM41, Staphylococcus aureus 209p, Micrococcus luteus B1314. Антимикробное действие пептида определяли по диаметру зон ингибирования роста тест-культуры. Результаты тестирования активности природного аурелина и пептида, полученного заявленным способом, представлены в таблице 3.

Таблица 3.

Антимикробная активность аурелина

Количество пептида

(мкг на лунку)

Диаметр зоны ингибирования роста тест-культуры в концентрациях 105 КОЕ/мл, мм (±0,5 мм)

Micrococcus luteus

Bacillus megaterium

Staphylococcus aureus

20,0

природный

10,0

12,0

4,0

Рекомбинантный

10,0

12,0

4,5

10,0

природный

6,5

11,0

3,5

Рекомбинантный

7,0

10,5

3,5

5,0

природный

6,5

10,0

3,0

Рекомбинантный

6,5

9,5

3,0

Показано, что очищенный аурелин в количестве 5 мкг/лунку проявляет антимикробную активность и ингибирует рост всех тестируемых бактерий. Наиболее чувствительной к пептиду культурой является B. megaterium. Активность рекомбинантного аурелина совпадает в пределах погрешности измерения с активностью природного пептида.

2.4. Биотехнологическое получение аурелина, меченного стабильным изотопом 15N, для изучения его пространственной структуры методом гетероядерной 1H,15N- ЯМР-спектроскопии.

Аурелин, тотально меченный стабильным изотопом 15N, был получен по методике, описанной в разделе 1.4,  с использованием плазмиды pE-His8-TrxL-Aur путем культивирования штамма E.coli BL21(DE3), трансформированного данной плазмидой, на бедной питательной среде М9, содержащей 15NH4Cl в качестве единственного источника азота. Используя образцы немеченого и 15N-меченого рекомбинантных аналогов аурелина, в лаборатории биомолекулярной ЯМР-спектроскопии ИБХ РАН (с.н.с., к.ф.-м.н. З.О.Шенкарев,  рук. лаб. проф. А.С.Арсеньев) была изучена пространственная структура пептида в водном растворе. Показано, что пространственная структура аурелина представляет собой небольшую глобулу с двумя -спиралями (остатки 10-14 и 24-32) и одной 310-спиралью (остатки 17-20). Структура стабилизирована тремя дисульфидными, 17 водородными связями между атомами основной цепи и одной водородной связью между HN Thr36 и O1 Asp5 (рис. 11).

Рис. 11. Пространственная структура аурелина в воде. Красным цветом отмечены отрицательно заряженные остатки (Asp5, Glu13, Asp21), синим – положительно заряженные (Arg6, His8, His10, Lys16, Lys20, Arg24, Lys28, Arg30, Lys34, Lys35). Структура имеет в своем составе две -спирали (остатки 10-14 и 24-32 – выделено красным) и одну 310-спираль (остатки 17-20 – выделено бирюзовым). Оранжевым цветом выделены дисульфидные связи (Cys3-Cys40, Cys12-Cys33, Cys19-Cys37). Водородная связь HN Thr36 – O1 Asp5 обозначена пунктирной линией.

Анализ структуры аурелина указывает на амфифильность молекулы пептида. На поверхности наблюдается небольшой гидрофобный регион, образованный боковыми группами остатков Ile11, Phe15, Phe18. Наличием гидрофобного региона и окружающего его кольца положительно заряженных остатков может быть обусловлено сродство пептида к мембранам бактериальных клеток, содержащим анионные липиды. Высказано предположение о том, что мембранная активность аурелина лежит в основе его антимикробного действия.

3. Биотехнологическое получение буфорина-2 из пищеварительного тракта дальневосточной жабы Bufo bufo gargarisans.

3.1. Гетерологичная экспрессия и очистка буфорина-2.

Одним из перспективных для клинического применения АМП является буфорин-2, впервые выделенный из пищеварительного тракта дальневосточной жабы Bufo bufo gargarisans (Park C.B.  et al., 1996). Буфорин-2 является фрагментом N-концевой части гистона H2A. Размер пептида составляет 21 аминокислотный остаток (trssraglqfpvgrvhrllrk, молекулярная масса 2435 Да). Пептид обладает широким спектром бактерицидного и фунгицидного действия, механизм которого, согласно последним исследованиям, состоит в образовании нестабильных тороидальных пор, быстрой транслокации антибиотика через мембрану и последующем связывании с нуклеиновыми кислотами. Минимальные ингибирующие концентрации буфорина-2 в отношение протестированных штаммов лежат в диапазоне 0,4–1,5 мкМ. В данных концентрациях пептид не проявляет гемолитической активности. Ранее было показано, что буфорин эффективен (особенно в комбинации с цефазолином) против метициллин-устойчивых штаммов Staphylococcus epidermidis, вызывающих серьезные инфекционные осложнения при трансплантации сосудов. Существующие системы экспрессии буфорина-2 в виде тандемных мультимеров (Lee J.H. et al., 2002) или в виде гибридного белка с фрагментом амидотрансферазы PurF (Pyo S.H. et al., 2004) позволяют получить буфорин-2, несущий  дополнительный C-концевой остаток гомосерина или N-концевой  остаток глицина.

В ходе выполнения данной работы созданы генетические конструкции для гетерологичной экспрессии буфорина-2, разработана  эффективная технология получения и очистки генно-инженерного буфорина, полностью идентичного природному пептиду. Созданные конструкции pET-KSI-Buf2 и pET-KSI-MIS-Buf2 позволяют с помощью одной стадии хроматографической очистки получать полностью идентичный природному буфорин-2 в количестве 5–10 мг/л культуры. Сравнение суммарных лизатов индуцированных клеток E. coli BL-21(DE3) с помощью ПААГ-электрофореза показало приблизительно равное содержание гибридного белка при использовании обеих конструкций. Для наработки буфорина-2 была выбрана система BL-21(DE3)/pET-KSI-Buf2. Высокое содержание гибридного белка в клетке позволяло ограничить его очистку выделением нерастворимой фракции клеточного белка (телец включения). После расщепление гибридного белка бромцианом молекулрная масса полученного пептида, определенная методом МАЛДИ-времяпролетной масс-спектрометрии,  соответствовала расчетной массе буфорина-2. Тонкая очистка буфорина-2 проводилась с помощью обращенно-фазовой ВЭЖХ.Чистота препарата подтверждалась с помощью МАЛДИ-времяпролетной масс-спектрометрии и электрофореза в ПААГ в присутствии SDS.

3.2. Антимикробная активность генно-инженерного буфорина-2.

Антимикробная активность генно-инженерного буфорина-2 определялась методом радиальной диффузии в агарозном геле со следующими тест-культурами: Escherichia coli C600,  Bacillus subtilis L1, Staphylococcus aureus 209p. Результаты тестирования активности буфорина-2 после 21 ч инкубации представлены в таблице  4.

Таблица 4. Антимикробная активность генно-инженерного буфорина-2.

Количество пептида

(мкг на лунку)

Диаметр зоны ингибирования роста тест-культуры, мм (±0,5 мм)

Escherichia coli C600

Bacillus subtilis L1

Staphylococcus aureus 209p

20,0

12,5

11,5

6,5

10,0

11,0

10,5

5,0

5,0

9,0

9,5

4,0

2,5

8,5

8,5

3,5

1,25

7,0

7,5

3,0

4. Поиск, выделение и структурно-функциональная характеристика нового дефенсина из проросших семян чечевицы обыкновенной Lens culinaris.

Известно, что в арсенале у растений имеется целый ряд защитных механизмов, в том числе гиперчувствительный ответ, утолщение клеточной стенки, повышение концентрации фитогормонов,  обеспечение локальной и системной резистентности, в том числе путем синтеза белков, связанных с патогенезом (Pathogenesis-Related Proteins или сокращенно PRP),  а также вторичных метаболитов, обладающих антимикробным действием. PRP являются стресс-индуцируемыми белками растений, синтезируются только в ответ на воздействие неблагоприятных факторов, таких как присутствие фитопатогенов, дефицит влаги, механическое повреждение, изменение температуры или обработка химическими агентами. Растения содержат большое число различных PRP, которые подразделяются на 17 классов. Активация синтеза PRP происходит под воздействием неблагоприятных абиотических и биотических факторов окружающей среды. Аналогичный эффект наблюдается  при прорастании семени, когда нарушается  целостность кожуры, являющейся эффективным физическим барьером, и молодой проросток оказывается в среде, густо населенной микроорганизмами. В настоящей работе был проведен поиск новых защитных белков и пептидов в проросших семенах чечевицы. Фракционирование суммарного белкового препарата, полученного в результате гомогенизации проросших семян чечевицы, проводилось методами гель-фильтрации, ионообменной и обращенно-фазовой хроматографии.

4.1. Поиск, выделение  и определение структуры нового дефенсина Lc-def.

Дефенсин чечевицы, названный Lc-def, был обнаружен и выделен в результате двухстадийного разделения объединенных фракций, полученных после гель-фильтрации и содержащих белки с Mr 3-6 кДа. Катионообменную хроматографию проводили на колонке Mono S. Масс-спектрометрический анализ выявил  присутствие  белка  с  m/z  [M+H]+  5441,1. Дальнейшая  его очистка осуществлялась с помощью обращенно-фазовой ВЭЖХ на колонке Luna С18.. Частичная N-концевая аминокислотная последовательность выделенного белка (KTXENLSDSFKGPXIPDGN-), установленная методом автоматического микросеквенирования,  имела значительное сходство с соответствующими последовательностями дефенсинов  бобовых растений. Выделенный дефенсин-подобный белок, названный Lc-def, содержал 8 остатков цистеина, образующих  четыре дисульфидные связи, что характерно для растительных дефенсинов. Число цистеиновых остатков и дисульфидных мостиков определяли, используя реакцию алкилирования белка 4-винилпиридином без предварительного восстановления дититреитолом и после него. 

Для того,  чтобы определить полную аминокислотную последовательность Lc-def, была выделена суммарная РНК, проведены обратная транскрипция и амплификация 3’- и 5’-концевых фрагментов  кДНК, которая проводилась в три этапа. На первом этапе была проведена ПЦР с двумя вырожденными ген-специфическими праймерами, комплементарными консервативным участкам нуклеотидной последовательности дефенсинов бобовых растений. На втором этапе амплификацию проводили с ген-специфическим праймером, комплементарным фрагменту сигнального пептида предшественника Lc-def. На третьем этапе  использовалась система вложенных праймеров, комплементарных 3’-нетранслируемой области кДНК. Структура полноразмерной кДНК предшественника дефенсина была установлена  путем сопоставления результатов секвенирования 3’- и  5’-концевых  фрагментов  и зарегистрирована в банке данных по нуклеотидным последовательностям GenBank под номером EF194158 (рис. 12).

Установленная нуклеотидная последовательность включает в себя открытую рамку считывания длиной 222 п.о., кодирующую последовательность 74 аминокислотных остатков предшественника дефенсина. Анализ аминокислотной последовательности, транслированной с кодирующей нуклеотидной последовательности, с помощью алгоритма SignalP v.3.0 (http://www.cbs.dtu.dk/services/SignalP), показал  высокую  вероятность наличия характерного для растительных дефенсинов сигнального пептида, отщепляемого по связи Ala27-Lys28 и состоящего из 27 аминокислотных остатков.

       Соответствие транслированной последовательности кДНК аминокислотной последовательности выделенного Lc-def было подтверждено путем проведения триптического гидролиза восстановленного белка. Рассчитанные с помощью программы Protean (DNASTAR) молекулярные массы триптических фрагментов дефенсина соответствовали массам фрагментов выделенного Lc-def, определенных методом МАЛДИ-времяпролетной масс-спектрометрии (рис. 12б).

В результате была установлена полная аминокислотная последовательность нового дефенсина Lc-def, которая была зарегистрирована в банке данных по аминокислотным последовательностям UNIPROT под номером P85530, а также структура его предшественника. Зрелый Lc-def состоит из 47 аминокислотных остатков и имеет расчетную молекулярную массу 5440,21 Да (EditSeq, DNASTAR), совпадение которой с экспериментальным значением m/z молекулярного иона свидетельствует об отсутствии посттрансляционных модификаций у дефенсина чечевицы.

В литературных источниках приводится классификация растительных дефенсинов, подразделяющая их на четыре группы в соответствии с  особенностями их структурной организации и функциональной активности. Все четыре группы характеризуются наличием консервативных  аминокислотных остатков. Однако классификация некоторых дефенсинов растений вызывает затруднения, поскольку их структурные и функциональные характеристики не вписываются ни в одну из упомянутых четырех групп. Поиск в базах данных аминокислотных и нуклеотидных последовательностей (http://www.ncbi.nlm.nih.gov/blast/Blast.cgi)  показал, что структура выделенного нами полноразмерного дефенсина чечевицы Lc-def имеет наибольшее сходство с неклассифицированными дефенсинами из семян бобовых растений (рис. 13).

Дефенсины данного ботанического семейства обладают выраженной противогрибковой активностью и обеспечивают защиту трансгенных растений от фитопатогенных грибов; в более высоких концентрациях они также подавляют рост бактерий. Помимо этого, данные белки ингибируют  обратную транскриптазу ВИЧ-1, обладают митогенной активностью в отношение мышиных спленоцитов и антипролиферативной активностью в отношение опухолевых клеток. Высокая степень гомологии и сходная функциональная активность дефенсинов бобовых растений дают основание выделить их в новую, пятую структурную группу, к которой  и принадлежит выделенный нами Lc-def.

4.2. Создание генно-инженерной конструкции для экспрессии рекомбинантного дефенсина из семян чечевицы Lens culinaris.

Создана генно-инженерная конструкция, позволяющая проводить препаративную экспрессию дефенсина из семян чечевицы Lens culinaris (Lc-Def) в клетках E. coli. В состав плазмидного вектора pE-Trx-Lc-Def для экспрессии гибридного белка, содержащего дефенсин чечевицы, были включены следующие регуляторные элементы: промотор РНК-полимеразы бактериофага T7, lac-оператор, консенсусный сайт связывания бактериальной рибосомы и стартовый кодон ATG. Открытая рамка считывания завершается стоп-кодоном TAA, а транскрибируемая область ограничивается терминатором транскрипции фага T7. Для подавления базальной экспрессии гена гибридного белка в состав вектора pE-Trx-Lc-Def был включен ген lac-репрессора (lacI). В состав вектора также входят сайт инициации репликации (Ori) плазмиды pBR322 и маркерный ген -лактамазы, детерминирующий устойчивость трансформированных плазмидой клеток Escherichia coli к ампициллину (до 500 мкг/мл) и позволяющий проводить отбор клеток, содержащих векторную ДНК, путем выращивания на соответствующей селективной питательной среде. Размер плазмиды составил 5903 п.о., размер кодируемого гибридного белка – 172 аминокислотных остатка (19,0 кДа). Конструкция pE-Trx-Lc-Def предназначена для функционирования в штаммах E. coli, способных синтезировать РНК-полимеразу фага T7.

Белок-носитель тиоредоксин А обеспечивает повышение уровня экспрессии целевого пептида за счет нейтрализации его токсичности в отношение клеток продуцента, а также препятствуя его деградации в гетерологичной системе. Тиоредоксин способен в высокой концентрации накапливаться в цитоплазме E.coli в растворимой форме и широко применяется для суперэкспрессии биологически активных полипептидов – в первую очередь для экспрессии полипептидов, обогащенных остатками цистеина, получение которых в нативной форме представляет собой во многих случаях трудноразрешимую задачу. Расщепление гибридного белка бромцианом по остатку метионина, введенному между последовательностями белка-носителя и дефенсина, позволяет получать рекомбинантный дефенсин, первичная структура которого идентична природной. Для предотвращения фрагментации белка-носителя при обработке бромцианом внутренние остатки метионина в его структуре были заменены методом направленного мутагенеза на другие остатки, близкие по физико-химическим свойствам. В целях упрощения очистки целевого продукта в состав гибридного белка Trx-Lc-Def была включена N-концевая аффинная метка – последовательность из восьми остатков гистидина, позволяющая проводить очистку гибридного полипептида методом аффинной хроматографии на сорбентах с иммобилизованными (хелатированными) ионами металлов, т.е. металлохелатную очистку.

Конструирование плазмидного вектора pE-Trx-Lc-Def осуществлялось путем лигирования BglII/XhoI-фрагмента плазмиды pET-31b(+) (Novagen), содержащего область инициации репликации, Т7 терминатор, гены -лактамазы и lac-репрессора, со вставкой, кодирующей ген гибридного белка. Искусственный ген, содержащий промотор транскрипции Т7 РНК-полимеразы, lac-оператор, участок связывания рибосомы и участок, кодирующий гибридный полипептид (последовательно связанные гистидиновый октамер, тиоредоксин с заменой M37L, сайт расщепления бромцианом и дефенсин), был получен путем синтеза набора олигонуклеотидов с последующей сборкой и амплификацией промежуточных и конечного продуктов при помощи полимеразной цепной реакции (ПЦР). Выбор структуры олигонуклеотидов для синтеза каждого из структурных элементов (промотора, оператора, сайта связывания рибосомы, тиоредоксина, аффинной последовательности, дефенсина) основывался на данных по их нуклеотидным последовательностям, доступных из открытых источников (банки данных GenBank, EMBL-Bank, DDBJ).

Фрагмент, кодирующий белок-носитель тиоредоксин (M37L), получали методом ПЦР-амплификации и направленного мутагенеза с помощью ген-специфических праймеров, используя в качестве исходной матрицы плазмиду pET32a(+), содержащую ген тиоредоксина. Последовательность, кодирующая дефенсин, была получена методом амплификации соответствующего участка природной кДНК препродефенсина с использованием ПЦР-праймеров, обеспечивающих замену двух редких аргининовых кодонов кодонами, предпочтительными для экспрессии в E.coli. На завершающей стадии синтеза последовательность гена амплифицировали с помощью праймеров, несущих на 5’-концах сайты узнавания рестриктаз BglII и XhoI. Продукт амплификации гидролизовали указанными рестриктазами, очищали электрофорезом в 1,5% агарозном геле, полосу ДНК размером 656 п.н. выделяли из геля методом электроэлюции в 15% раствор ПЭГ-6000 и лигировали с фрагментом ДНК размером 5,25 тыс. п.н., полученным в результате обработки плазмиды pET31b(+) рестриктазами BglII и XhoI. В результате лигазной реакции получали кольцевую ковалентно замкнутую ДНК размером 5,8 п.н. Продуктами лигазной реакции трансформировали компетентные клетки E.coli DH10B, приготовленные с помощью 0,1 М хлорида кальция. После трансформации суспензию бактерий смешивали с питательной средой LB, растят 1 ч при 37°C и высевали на чашки Петри с LB-агаром, содержащим 50 мкг/мл ампициллина.

Первичный отбор клонов, содержащих нужную плазмиду, осуществляли методом «ПЦР с клонов» с использованием праймеров на плазмидный остов и вставку. Отобранные клоны подращивали в жидкой питательной среде и выделяли плазмидную ДНК, которую анализировали на наличие вставки с помощью рестрикционного анализа. Минипрепаративное выделение экспрессирующей плазмиды проводилось с помощью наборов реактивов и микроколонок Zymo Research. Для наработки плазмидной ДНК использовался штамм E. coli DH-10B (RecA–). Окончательное строение плазмид, содержащих требуемый фрагмент, подтверждали секвенированием нуклеотидной последовательности по Сэнгеру. По данным секвенирования отбирали плазмиду со вставкой, нуклеотидная последовательность которой полностью соответствовала заданной  (Рис. 14).

Рис. 14. Физическая карта рекомбинантной плазмиды pE-Trx-LcDef. BglII, XhoI – сайты рестрикции; pBR322 Ori – участок инициации репликации плазмиды; bla – ген устойчивости к -лактамным антибиотикам; lacI – ген lac-репрессора; T7 promoter – промотор транскрипции; T7 terminator – терминатор транскрипции; lac operator – сайт связывания lac-репрессора; RBS – сайт связывания рибосомы; His8 – аффинная последовательность из восьми остатков гистидина; Trx – участок, кодирующий тиоредоксин; Lc-Def – последовательность, кодирующая дефенсин.

4.3. Биотехнологический способ получения рекомбинантного дефенсина из семян чечевицы Lens culinaris, тотально меченного стабильными изотопами  15N.

Возможность использования плазмиды pE-Trx-Lc-Def для получения дефенсина, тотально меченного стабильными изотопами, была подтверждена путем культивирования штамма E.coli BL21(DE3), трансформированного данной плазмидой, на бедной питательной среде М9, содержащей 15N-аммония хлорид в качестве единственного источника азота. Индукцию экспрессии гена гибридного белка осуществляли путем добавления в культуральную жидкость 0.2 мМ изопропил--D-тиогалактозида.

Препаративную экспрессию гибридного белка His8-TrxL-Lc-def проводили при температуре 37С в двухлитровых колбах, заполненных на четверть полного объема культуральной средой. Индукцию осуществляли путем добавления изопропилтио--D-галактозида до концентрации 0,2 мМ. Начальная плотность культуры при инокуляции в бедную среду (OD600) составляла 0,1, плотность в момент индукции – 0,771, конечная плотность культуры после инкубации в течение 6 ч – 1,24. Клеточный осадок получали центрифугированием при 9000 g в течение 5 минут, после чего ресуспендировали его и подвергали ультразвуковой обработке. Полученную суспензию центрифугировали, и  осветленный лизат разделяли с помощью аффинной хроматографии на колонке при нормальном давлении. Элюцию гибридного белка проводили повышением концентрации имидазола в денатурирующем буфере с 20 до 500 мМ. К разбавленному элюату добавляли -меркаптоэтанол до конечной концентрации 2%, после чего полученную смесь инкубировали в течение часа. Ренатурацию гибридного белка осуществляли диализом против воды через мембрану с размером пор 1 кДа. Целевой пептид получали в результате расщепления гибридного белка бромцианом. Тонкую очистку дефенсина осуществляли с помощью обращенно-фазовой ВЭЖХ. Выход гибридного белка с 1 л культуры составил 35 мг, целевого пептида – 1,5 мг.

Полученный пептид продемонстрировал идентичность природному дефенсину в условиях ПААГ-электрофореза и обращенно-фазовой ВЭЖХ. По данным МАЛДИ-времяпролетной масс-спектрометрии молекулярная масса меченного пептида на 73 Да превысила молекулярную массу природного пептида, составив 5513,694 Да, что сответствует расчетной массе тотально меченного изотопом 15N дефенсина.

4.4. Антимикробная активность дефенсина  Lc-def.

Антимикробная активность Lc-def определялась методом серийных разведений антибиотика в жидкой питательной среде с культурой спор. Противогрибковая активность природного дефенсина  была исследована в отношение двух фитопатогенных грибов  из отдела аскомицетов Aspergillus niger VKM F-2259 и Alternaria alternata VKM F-3047. Противогрибковая активность рекомбинантного аналога Lc-def была исследована в отношение еще семи фитопатогенных грибов (Aspergillus versicolor VKM F-114, Fusarum solani VKM F-142, Fusarum culmorum VKM F-844, Fusarum oxysporum ТСХА-4, Neurospora crassa VKM F-184,  Botrytis cinerea VKM F-85, Ascochyta pisi VKM F-1173). Результаты тестирования показали, что дефенсин чечевицы характеризуется специфичностью действия и ингибирует рост шести использованных тест-культур (табл. 5). Наиболее чувствительными к Lc-def являются возбудители фузариоза и серой гнили бобовых и злаковых растений F. culmorum и B. cinerea, соответственно, а также N. crassa, 100% ингибирование роста которого наблюдается в присутствии Lc-def в коцентрации 37 мкм/л (рис. 15). В то же время, дефенсин чечевицы не влияет на прорастание спор и рост таких фитопатогенов, как F. solani, A. alternata и A. pisi в максимальной использованной концентрации 37 мкм/л.

Фитопатогенные грибы

IC50, мкМ/л

Aspergillus niger VKM F-2259

28,7

Aspergillus versicolor VKM F-114

37

Botrytis cinerea VKM F-85

4,65-9,25

Fusarum culmorum F-844

18,5-37

Fusarum oxysporum ТСХА-4

>37

Neurospora crassa VKM F-184

18,5-37

 

Характерную для растительных дефенсинов специфичность противогрибкового действия связывают с возможным механизмом их действия. В отличие от большинства катионных АМП дефенсины растений вызывают нарушение проницаемости клеточной мембраны фитопатогенных грибов не в результате электростатического взаимодействия с отрицательно заряженными  компонентами мембраны, а в результате взаимодействия с высокоаффинными сайтами связывания на плазматической мембране грибной клетки. Идентифицированные для некоторых растительных дефенсинов сайты связывания представляют собой специфичные для разных видов фитопатогенных грибов кислые и нейтральные гликосфинголипиды. Следствием связывания растительного дефенсина со специфическим рецептором может являться либо встраивание его в мембрану фитопатогена с образованием ион-проницаемой поры, либо активация трансдуцирующих соедине­ний, влияющих на активность ионных каналов или транспортеров. Является ли ингибирование грибкового роста прямым следствием изменения проницаемости мембраны фитопатогена или результатом взаимодействия  растительных дефенсинов с внутриклеточной мишенью, пока остается неясным. 

Помимо антимикробной активности в литературе была описана способность растительных дефенсинов специфически ингибировать активность протеолитических ферментов. Два негомологичных дефенсина из семян кассии трубчатой (Cassia fistula) и вигны початковой (Vigna unguiculata) ингибируют активность трипсина, но не влияют на протеолитические свойства химотрипсина. Авторами было высказано предположение о механизме ингибирования, в основе которого лежит взаимодействие Lys25 дефенсина кассии или Lys11 тионина Cp-1 вигны с трипсином. Учитывая, что дефенсин чечевицы Lc-def содержит оба значимых, по мнению авторов гипотезы, остатков  Lys, нами было проведено исследование влияния Lc-def на активность трипсина и химотрипсина c использованием в качестве субстратов L-BAPNA (n-нитроанилид--N-бензоил-D,L-аргинина) и -казеина, соответственно.  Было показано, что Lc-def не влияет на активность упомянутых протеолитических ферментов. Таким образом, нами установлено, что присутствие в структуре растительных дефенсинов аминокислотных остатков Lys11 и Lys25 не является достаточным условием для проявления способности ингибировать активность трипсина.

4.5. Исследование пространственной структуры дефенсина чечевицы в водном растворе.

Все дефенсины растений имеют схожую третичную структуру, представленную тремя складчатыми -листами и одной -спиралью ( конфигурация) и стабилизированную четырьмя дисульфидными связями (Cys1-Cys8, Cys2-Cys5, Cys3-Cys6 и Cys4-Cys7). Дисульфидная связь Cys1-Cys8 образована цистеинами, расположенными соответственно в N- и С-концевых участках структуры, что делает дефенсины растений псевдоциклическими белками.

Используя полученные образцы немеченого и 15N-меченого рекомбинантных аналогов пептида, в лаборатории биомолекулярной ЯМР–спектроскопии ИБХ РАН (с.н.с. З.О.Шенкарёв, рук. лаб. проф. А.С.Арсеньев) была определена пространственная структура дефенсина Lc-def в водном растворе. На рис. 16 показана  полученная структура, которая  представляет собой небольшую глобулу с одной -спиралью (остатки 21-27) и тремя -тяжами (остатки 2-6, 32-36 и 41-47). Вся структура стабилизирована 4 дисульфидными и 16 водородными связями между атомами основной цепи.

Анализ пространственной структуры дефенсина указывает на отсутствие явно выраженной амфифильности у молекулы пептида. На поверхности пептида не наблюдается протяженных гидрофобных регионов, а положительно и отрицательно заряженные остатки распределены практически равномерно. Подобные свойства дефенсина Lc-def, возможно, предопределяют отсутствие у пептида мембранной активности. Тем не менее, небольшой положительный заряд поверхности пептида (общий заряд +2) может обуславливать слабое сродство молекулы дефенсина к мембранам, содержащим анионные липиды.

Рис. 16. Пространственная структура дефенсина Lc-def в водном растворе в ленточном представлении. Красным цветом отмечены отрицательно заряженные остатки, синим – положительно заряженные. Жёлтым цветом выделены дисульфидные связи (Cys3-Cys47, Cys14-Cys35, Cys20-Cys41, Cys24-Cys43).

5. Поиск, выделение и структурно-функциональная характеристика  новых липид-транспортирующих белков из проросших семян чечевицы обыкновенной Lens culinaris.

5.1. Выделение и определение первичной структуры новых липид-транспортирующих белков чечвицы. 

Четыре новых липид-транспортирующих белка (LTP) чечевицы были выделены из просших семя чечевицы с помощью гель-фильтрации, ионообменной хроматографии и обращенно-фазовой ВЭЖХ.  Масс-спектрометрический анализ полученных после ВЭЖХ фракций выявил присутствие молекулярных ионов с m/z [M+H]+  9121,9,  9135,0,  9269,1 и 9283,1. Последовательности первых 24 аминокислотных остатков, установленные методом N-концевого автоматического микросеквенирования по Эдману,  оказались идентичными для всех четырех белков (AISXGAVTSDLSPXLTYLTGGPGP-). N-Концевая аминокислотная последовательность выделенных белков, гомологичная  первичной структуре белков подкласса LTP1, была депонирована в базы данных SWISS-PROT и TrEMBL под номером P84255. В результате проведенной реакции алкилирования белков 4-винилпиридином без предварительного восстановления дититреитолом  и после него было показано, что каждый  из выделенных LTP чечевицы содержит 8 остатков цистеина, образующих четыре дисульфидных связи. С-концевые аминокислотные остатки были определены путем расщепления белков смесью карбоксипептидаз А и В.  Для установления полных первичных структур LTP чечевицы с помощью молекулярного клонирования и секвенирования кДНК.

Для установления структур кДНК использовали метод быстрой амплификации концов кДНК (RACE).  Структура вырожденных ген-специфических праймеров для амплификации 3’-концов кДНК на первом этапе была выбрана, исходя из N-концевой аминокислотной последовательности выделенных LTP. На втором этапе для амплификации 5’-концов кДНК были использованы ген-специфические праймеры, комплементарные 3’-нетранслируемым областям кДНК (рис. 17а). В результате клонирования и секвенирования 3’- и 5’-концевых фрагментов нами была установлена структура шести полноразмерных кДНК предшественников LTP. Пять нуклеотидных последовательностей [номера GenBank: AY793553 (Lc-LTP1), AY793554 (Lc-LTP2), AY793555 (Lc-LTP3), AY793558 (Lc-LTP4), AY793557 (Lc-LTP6)] включают в себя открытую рамку считывания длиной 354 п.о., кодирующую белки-предшественники, состоящие  из 118 аминокислотных остатков. Шестая последовательность [номер GenBank AY793556 (Lc-LTP5)] содержит открытую рамку считывания длиной 348 п.о., кодирующую укороченный на две аминокислоты белок-предшественник, состоящий из 116 аминокислотных остатков. Анализ аминокислотных последовательностей с помощью алгоритма SignalP v.3.0 показал высокую вероятность наличия сигнального пептида, состоящего  из 24-25 аминокислотных остатков и отщепляемого по связям Ala25-Ala26 (в случае Lc-LTP1 и Lc-LTP3), Gly25-Ala26 (для Lc-LTP2, Lc-LTP4 и Lс-LTP6) и Gly24-Ala25 (в случае Lc-LTP5). Три из выделенных LTP чечевицы (Lc-LTP2,4,6) очень близки по своей структуре. Lc-LTP2 и Lc-LTP4 различаются  между собой всего двумя аминокислотными остатками: в положении 85 в зрелой части белков (Thr/Ser)  и  в  положении 14 в сигнальном пептиде (Met/Ile). Изоформы Lc-LTP4 и Lc-LTP6 отличаются только на один аминокислотный остаток в положении 77 (Asn/Asp). Наименьшее сходство со структурами других липид-транспортирующих белков чечевицы имеет Lc-LTP1 (рис. 18). Выделенные нами липид-транспортирующие белки из чечевицы обладают высокой степенью гомологии с LTP из семян нута Cicer arietinum: 76% идентичных остатков в случае Lc-LTP2 и 77% для Lc-LTP4.

Для того, чтобы соотнести аминокислотные последовательности выделенных нами и известных ранее LTP, был проведен триптический гидролиз восстановленных и S-пиридилэтилированных  белков, который привел к образованию 13 фрагментов (рис. 17б).

Рассчитанные с помощью программы Protean (DNASTAR) молекулярные массы триптических фрагментов Lc-LTP2,4,6 соответствовали массам фрагментов выделенных LTP, определенных методом МАЛДИ-времяпролетной масс-спектрометрии. Принимая во внимание то, что разница между молекулярными массами Lc-LTP4 и Lc-LTP6 составляет  всего 1,0 Да,  было  выполнено  микросеквенирование  фрагмента  XI CGV(N,D)IPYK при помощи тандемной МАЛДИ-времяпролетной масс-спектрометрии, которое позволило идентифицировать остаток Asn77. В результате было установлено, что выделенные LTP чечевицы с m/z молекулярных ионов [M+H]+  9269,1 и 9283,1 соответствуют зрелым белкам Lc-LTP4 и Lc-LTP2 (расчетные молекулярные массы 9268,7 Да и 9282,7 Да, соответственно; EditSeq, DNASTAR). Выделенные белки с m/z молекулярных ионов [M+H]+ 9121,9 и 9135,9,  названные Lc-LTP8 и Lc-LTP7, являются укороченными изоформами Lc-LTP4 и Lc-LTP2 без С-концевого Phe (расчетные молекулярные массы 9121,5 Да и 9135,5 Да, соответственно; EditSeq, DNASTAR, рис. 18). Так как в процессе выделения белков использовался коктейль ингибиторов протеаз, присутствие укороченных изоформ Lc-LTP7,8, возможно, является результатом экспрессии соответствующих генов или ферментативного отщепления С-концевого остатка непосредственно в растительных клетках.

5.3. Создание генно-инженерной конструкции для экспрессии рекомбинантного липид-транспортирующего белка из семян чечевицы Lens culinaris. Биотехнологический способ получения  LTP чечевицы, тотально меченного стабильными изотопами 15N.

Создана генно-инженерная конструкция, позволяющая проводить препаративную экспрессию липид-транспортирующего белка из семян чечевицы Lens culinaris (Lc-LTP) в клетках E. coli, в том числе  на бедной питательной среде, содержащей источники 15N. Особенностью полученной плазмидной конструкции pE-Trx-Lc-LTP является присутствие в ее составе гена, кодирующего один из белков подсемейства липид-транспортирующих белков чечевицы (Lc-LTP) в составе гибридного белка His8-Trx-Lc-LTP, который содержит белок тиоредоксин в качестве белка-носителя. С целью дальнейшего высвобождения целевого белка Lc-LTP из молекулы гибридного белка His8-Trx-Lc-LTP между последовательностями Lc-LTP и тиоредоксина был введен сайт, позволяющий проводить избирательное расщепление гибридного полипептида химическим способом.

В состав плазмидного вектора pE-Trx-Lc-LTP были включены регуляторные элементы, необходимые для достижения высокого уровня экспрессии в цитоплазме E.coli: промотор РНК-полимеразы бактериофага T7, lac-оператор, консенсусный сайт связывания бактериальной рибосомы и стартовый кодон ATG. Открытая рамка считывания завершается стоп-кодоном TAA, а транскрибируемая область ограничивается терминатором транскрипции фага T7. Для подавления базальной экспрессии гена гибридного белка в состав вектора pE-Trx-Lc-LTP был включен ген lac-репрессора (lacI). В состав вектора также введен сайт инициации репликации (Ori) плазмиды pBR322 и маркерный ген -лактамазы, детерминирующий устойчивость трансформированных плазмидой клеток Escherichia coli к ампициллину (до 500 мкг/мл) и позволяющий проводить отбор клеток, содержащих векторную ДНК, путем выращивания на соответствующей селективной питательной среде. Размер плазмиды составил 6041 п.о., размер кодируемого гибридного белка – 219 аминокислотных остатка (23,0 кДа). Конструкция pE-Trx-Lc-LTP предназначена для функционирования в штаммах E. coli, способных синтезировать РНК-полимеразу фага T7.

Расщепление гибридного белка бромцианом по остатку метионина, введенному между последовательностями белка-носителя и липид-транспортирующего белка, позволило получить рекомбинантный липид-транспортирующий белок, первичная структура которого полностью идентична природной. Очистку целевого белка Lc-LTP упростили за счет включения в состав гибридного полипептида Trx-Lc-LTP октагистидиновой аффинной метки – аминокислотной последовательности, позволяющей проводить металлохелатную очистку гибридного полипептида очистку.

Конструирование плазмидного вектора pE-Trx-Lc-LTP осуществлялось путем лигирования BglII/XhoI-фрагмента плазмиды pET-31b(+) (Novagen), содержащего область инициации репликации, Т7 терминатор, гены -лактамазы и lac-репрессора, со вставкой, кодирующей ген гибридного белка. Искусственный ген гибридного белка, содержащий промотор транскрипции Т7 РНК-полимеразы, lac-оператор, участок связывания рибосомы и участок, кодирующий гибридный полипептид был получен путем синтеза набора олигонуклеотидов с последующей сборкой и амплификацией промежуточных и конечного продуктов при помощи полимеразной цепной реакции (ПЦР). Фрагмент, кодирующий белок-носитель тиоредоксин (M37L), получали методом ПЦР-амплификации и направленного мутагенеза с помощью ген-специфических праймеров, используя в качестве исходной матрицы плазмиду pET32a(+), содержащую ген тиоредоксина. Последовательность, кодирующая липид-транспортирующий белок, была получена методом амплификации соответствующего участка природной кДНК предшественника липид-транспортирующий белка. На завершающей стадии синтеза последовательность гена амплифицировали с помощью праймеров, несущих на 5’-концах сайты узнавания рестриктаз BglII и XhoI. Продукт амплификации гидролизовали указанными рестриктазами, очищали электрофорезом в агарозном геле, полосу ДНК размером 790 п.н. выделяли из геля методом электроэлюции и лигировали с фрагментом ДНК размером 5,25 тыс. п.н., полученным в результате обработки плазмиды pET31b(+) рестриктазами BglII и XhoI. В результате лигазной реакции получали кольцевую ковалентно замкнутую ДНК размером 6,0 тыс. п.н. Продуктами лигазной реакции трансформировали компетентные клетки E.coli DH10B. После трансформации суспензию бактерий смешивали с питательной средой LB, растили 1 ч при 37°C и высевали на чашки Петри с LB-агаром, содержащим 50 мкг/мл ампициллина.

Отбор клонов, содержащих нужную плазмиду, осуществляли методом «ПЦР с клонов» с использованием праймеров на плазмидный остов и вставку. Отобранные клоны подращивали в жидкой питательной среде и выделяли плазмидную ДНК, которую анализировали на наличие вставки с помощью рестрикционного анализа. Минипрепаративное выделение экспрессирующей плазмиды проводилось с помощью наборов реактивов и микроколонок Zymo Research. Для наработки плазмидной ДНК использовался  штамм  E. coli  DH-10B (RecA–). 

Рис. 19. Физическая карта рекомбинантной плазмиды pE-Trx-Lc-LTP. BglII, XhoI – сайты рестрикции; pBR322 Ori – участок инициации репликации плазмиды; bla – ген устойчивости к -лактамным антибиотикам; lacI – ген lac-репрессора; T7 promoter – промотор транскрипции; T7 terminator – терминатор транскрипции; lac operator – сайт связывания lac-репрессора; RBS – сайт связывания рибосомы; His8-Trx-Lc-LTP – последовательность, кодирующая гибридный белок, включающий аффинный участок из восьми остатков гистидина (His8), тиоредоксин (Trx) и последовательность липид-транспортирующего белка (Lc-LTP).

Окончательное строение плазмид, содержащих требуемый фрагмент, подтверждали секвенированием нуклеотидной последовательности по Сэнгеру. По данным секвенирования отбирали плазмиду со вставкой, нуклеотидная последовательность которой полностью соответствовала заданной (рис. 19).

Препаративную экспрессию гибридного белка His8-TrxL-Lc-LTP2 проводили по методике, аналогичной описанной выше. Тонкую очистку липид-транспортирующего белка Lc-LTP2 осуществляли с помощью обращенно-фазовой ВЭЖХ. Выход гибридного белка с 1 л культуры составил 32 мг, целевого белка – 1,2 мг. Полученный белок продемонстрировал идентичность природному Lc-LTP2 в условиях ПААГ-электрофореза и обращенно-фазовой ВЭЖХ.

Возможность использования плазмиды pE-Trx-Lc-LTP для получения липид-транспортирующего белка, тотально меченного стабильным изотопом 15N, была подтверждена путем культивирования штамма E.coli BL21(DE3), трансформированного данной плазмидой, на бедной питательной среде М9, содержащей 15NH4Cl в качестве единственного источника азота. По данным МАЛДИ-времяпролетной масс-спектрометрии молекулярная масса меченого белка на 113 Да превысила молекулярную массу природного аналога, составив 9395,892 Да, что полностью соответствует расчетной массе тотально 15N-меченого аналога Lc-LTP2.

5.4. Характеристика биологической активности выделенных LTP.

Присутствие нескольких изоформ белков в одном растении типично для класса LTP. Представители данного семейства белков  обладают антимикробной активностью и способностью связывать и переносить липиды, являются многофункциональными белками и, предположительно, принимают участие в таких биологических процессах в растениях, как синтез кутина, эмбриогенез, адаптация к стрессу (холод, засуха, засоление почвы и т.д.), защита растений от фитопатогенов. Считается, что разные изоформы LTP выполняют различные функции в растениях, и уровень их экспрессии зависит от условий окружающей среды. В подтверждение присутствия в семенах чечевицы множественных изоформ LTP нами были обнаружены мРНК шести белков Lc-LTP1-6, которые, по-видимому, синтезируются на разных стадиях развития растения. Синтез изоформ Lc-LTP2,4,7,8, выделенных нами из проращённых в течение трех дней семян чечевицы, происходит на ранней стадии развития проростков и, возможно, обусловлен участием этих белков в борьбе с инфекциями и мобилизации липидов при переходе эмбриональных клеток из фазы покоя  в фазу активного метаболизма при прорастании семян.

Защитная функция выделенных LTP была подтверждена наличием антимикробной активности, которую определяли, как и в случае дефенсина, методом серийных разведений антибиотика в жидкой питательной среде. Антимикробная активность природных LTP чечевицы  была исследована в отношение двух фитопатогенных грибов - Aspergillus niger VKM F-2259 и Alternaria alternata VKM F-3047, а также в отношение грам-отрицательной бактерии Agrobacterium tumefaciens А281.

Тест-микроорганизмы

IC50, мкМ/л

Грам-отрицательные бактерии

Agrobacterium tumefaciens А281

27,0-40,5

Фитопатогенные грибы

Aspergillus niger VKM F-2259

17,5

Botrytis cinerea VKM F-85

10,9-21,7

Fusarum culmorum F-844

>21,7

Neurospora crassa VKM F-184

>21,7

Противогрибковая активность рекомбинантного аналога Lc-LTP2 была исследована в отношение еще семи фитопатогенных грибов (Aspergillus versicolor VKM F-114, Fusarum solani VKM F-142, Fusarum culmorum VKM F-844, Fusarum oxysporum ТСХА-4, Neurospora crassa VKM F-184,  Botrytis cinerea VKM F-85, Ascochyta pisi VKM F-1173). Результаты тестирования показали, что LTP чечевицы обладают как антибактериальной, так и противогрибковой активностью и ингибируют рост шести использованных тест-культур (табл. 6).

Наиболее чувствительными к LTP чечевицы являются возбудители аспергиллезной и серой гнили растений A. niger  и B. cinerea, соответственно, а также почвенная бактерия A. tumefaciens, вызывающая опухоли у растений (рис. 20). В то же время, LTP чечевицы не влияют на прорастание спор и рост таких фитопатогенов, как A. versicolor, A. alternata, A. pisi, F. oxysporum и F. solani в максимальной использованной концентрации 21,7 мкм/л.

Известно, что некоторые представители класса LTP являются растительными аллергенами, участвующими в развитии аллергических реакций на пыльцу, растительные продукты и латекс. Чечевица является основным бобовым растением, вызывающим аллергические реакции у детей, живущих  в странах Средиземноморского бассейна и в Индии. Ранее в семенах чечевицы были обнаружены два аллергена: субъединица -вицилина Len c 1 (47 кДа) и специфический для семян биотинилированный белок Len c 2 (66 кДа). Совместно с отделом экспериментальной иммунологии Академического медицинского центра г. Амстердама (Нидерланды) нами было проведено исследование взаимодействия  природных LTP чечевицы и рекомбинантного аналога Lc-LTP2 с IgE из сывороток пациентов с пищевой аллергией. Результаты иммуноблоттинга (рис. 21) и иммуноферментного анализа с использованием тест-системы ImmunoCap показали, что в сыворотках пациентов с пищевой аллергией на чечевицу, горох, орехи, фрукты и другие продукты присутствуют IgE, специфичные к LTP чечевицы. Анализ полученных данных позволил прийти к выводу о том,  что LTP чечевицы являются перекрестными аллергенами и имеют наибольшее сходство с Ara h 9 из арахиса. LTP чечевицы были внесены нами в базу данных по аллергенам (www.allergen.org) Международного союза иммунологических обществ (IUIS) под аббревиатурой Len c 3.  Таким образом, чечевица является третьим после арахиса и стручковой фасоли бобовым растением, из которого были выделены LTP, охарактеризованные как новые аллергены.

5.5. Исследование пространственной структуры LTP чечевицы в водном растворе.

Используя полученные образцы немеченого и 15N-меченого рекомбинантных аналогов LTP чечевицы, в лаборатории биомолекулярной ЯМР–спектроскопии ИБХ РАН (с.н.с. З.О.Шенкарёв, рук. лаб. проф. А.С.Арсеньев) была определена пространственная структура белка  Lc-LTP2 в водном растворе. На рис. 22 показана  структура Lc-LTP2, которая  представляет собой связку из четырёх -спиралей, сформированных аминокислотными остатками на участках полипептидной цепи Gly5-Leu18, Pro26-Ala37, Thr42-Lys53 и Thr64-Cys74. Кроме того, в структуре на участках Ala55-Ser58 и Cys88-Thr90 наблюдаются отдельные витки 310-спирали, а на участке Cys74-Cys88 вблизи С-концевого остатка находится длинная неупорядоченная петля. Пространственная структура связки из четырёх -спиралей характерна для всех LTP первого семейства.

Рис 22.  Пространственная структура Lc-LTP2 в водном растворе в ленточном представлении. Синим цветом выделены дисульфидные связи (Cys4-Cys51, Cys14-Cys28, Cys29-Cys74, Cys49-Cys88).

Анализ установленной пространственной структуры показывает, что поверхность молекулы Lc-LTP2 в основном гидрофильна, но в составе белка Lc-LTP2 значительное число гидрофобных остатков (Ala, Ile, Leu и Val) обращены внутрь молекулы и формируют гидрофобный канал (Рис. 23).

Рис. 23. Распределение гидрофобных остатков (выделены жёлтым цветом)  в молекуле Lc-LTP2. Показаны консервативные остатки Asp44, Arg45 и Tyr80.

Первые три спирали амфифильны и параллельны этому каналу и ограничивают его с одной стороны, с другой стороны канал ограничен четвертой спиралью и С-концевой петлей. Аналогичные гидрофобные каналы наблюдаются в пространственных структурах всех белков семейства LTP. Именно в этой гидрофобной полости находится сайт связывания липидных молекул. У входа в полость расположены консервативные остатки Tyr80 и Arg45. Согласно литературным данным, остаток Tyr80 образует водородные связи с полярной головкой связанного липида. Боковая цепь заряженного остатка Arg45 направлена внутрь канала. Этот остаток, возможно, отвечает за электростатическое взаимодействие с полярными головками липидов.

6. Структурно-функциональное изучение антибиотиков-пептаиболов из грибов Emericellopsis salmocynnemata и Emericellopsis minima.

Пептаиболы представляют собой семейство мембрано-активных антимикробных пептидов, выделенных из мицелиальных  спорообразующих грибов  [царство – грибы (Fungi), отдел – настоящие грибы (Eumycota), подотдел – аскомицеты (Ascomycotina), класс - эуаскомицеты (Euascomycetes)]. Термин «пептаиболы» указывает на пептидную природу этих антибиотиков, наличие в их составе α,α-диалкиламинокислот, в частности α-аминоизомасляной кислоты (Aib),  а также С-концевых 1,2-аминоспиртов.  Представители этого семейства являются относительно короткими пептидами (7-24 аминокислотных остатков), обладающими антибактериальной и антигрибковой активностью. Установлено также, что пептаиболы проявляют антипротозойное действие, в частности, против паразитических простейших рода Plasmodium - возбудителей малярии;  рода Trypanosoma – возбудителей сонной болезни и болезни Шагаса (трипаносомоза); рода Entamoeba, вызывающей дизентерийный амёбиаз. сонная болезнь и        К семейству пептаиболов относится группа антибиотиков зервамицинов, выделенных из гриба Emericellopsis salmosynnemata. Ранее в культурах различных штаммов гриба обнаружено и охарактеризовано 11 изоформ пептида, среди которых преобладающими являются зeрвамицин IIA (Zrv-IIA) и зервамицин IIB (Zrv-IIB). Зервамицины содержат 15 аминокислотных остатков и  С-концевой остаток аминоспирта фенилаланинола. Первичная структура Zrv-IIA и Zrv-IIB практически идентична, за исключением аминокислотного остатка в положении 4:

Zrv-IIA

Ac-Trp1-Ile2-Gln3-Aib4-Ile5-Thr6-Aib7-Leu8-Aib9-Hyp10-Gln11-Aib12-Hyp13-Aib14-Pro15-Phl16

Zrv-IIB

Ac-Trp1-Ile2-Gln3-Iva4-Ile5-Thr6-Aib7-Leu8-Aib9-Hyp10-Gln11-Aib12-Hyp13-Aib14-Pro15-Phl16, где Aib - α-аминоизомасляная кислота, Iva – D-изовалин, Hyp - 4-гидроксипролин, Phl - фенилаланинол.

Зервамицин образует в мембранах серию ион-проводящих агрегатов. Характерной особенностью зервамициновой проводимости является ее зависимость от приложенного электрического поля. В этом отношении зервамицин может рассматриваться как простейшая модель ионных каналов возбудимых мембран. Изучение  биологических свойств зервамицинов показало, что они не только обладают выраженной активностью против грам-положительных и грам-отрицательных бактерий, но  и проявляют антипротозойные  свойства в отношение к устойчивым формам возбудителя малярии Plasmodium falciparum.

Еще один представитель семейства пептаиболов - антиамёбин I - имеет следующую структуру:

Ac-Phe1-Aib2-Aib3-Aib4-Iva5-Gly6-Leu7-Aib8-Aib9-Hyp10-Gln11-Iva12-Hyp13-Aib14-Pro15-Phl16.

Антиамёбины также обладают антимикробными и антипротозойными, в частности, антиамёбными и противомалярийными свойствами. В модельных системах эти пептаиболы демонстрируют значительную мембранную активность и эффективное каналообразование. Однако антиамёбин I имеет более низкую биологическую активность по сравнению с зервамицином IIB.

Нами были разработаны эффективные методики выделения зервамицина IIB из гриба Emericellopsis salmosynnemata (штамм 336 IMI58330) и антиамёбина I из гриба Emericellopsis minima (штамм F1483).

6.1. Биотехнологический способ получения пептидных антибиотиков  зервамицина  IIB и антиамёбина I, тотально меченных стабильными изотопами 15N и 13C

Современные методы гетероядерной ЯМР-спектроскопии позволяют изучать конформацию мембрано-активных пептидов как в растворе, так и при их непосредственном взаимодействии с липидным бислоем. Применение комплексных методов 1H,13C,15N-ЯМР-спектроскопии и использование тотально меченых соединений в подобных исследованиях позволяют значительно увеличить объем получаемых данных и повысить качество рассчитанных структур. Получение тотально меченых препаратов биологически активных соединений  целесообразно проводить биотехнологическим методом, то есть путём культивирования соответствующих штаммов-продуцентов на средах, содержащих атомы только того изотопа, который должен быть включён в молекулы целевых соединений. В данной работе представлены результаты применения биотехнологического подхода для получения тотально меченого 15N,13С-меченого  препарата пептидного антибиотиков зервамицина IIB и антиамёбина I.

Для получения препаратов пептидных антибиотиков зервамицина IIB и антиамёбина I использовали культуры штаммов-продуцентов Emericellopsis salmosynnemata 336 IMI58330 и Emericellopsis minima F1483, соответственно. Известно, что максимальный выход пептаиболов наблюдается при культивировании грибов-продуцентов на полноценной среде с высоким содержанием глюкозы. В наших предварительных опытах было установлено, что использование даже половинных концентраций компонентов среды приводит к резкому снижению уровня накопления пептаиболов. На основании этих данных было сделано предварительное заключение, что ростовые среды для получения препаратов тотально меченых зервамицина IIB и антиамёбина I должны содержать ростовые факторы в тех же концентрациях, что и в стандартной полноценной среде для E.salmosynnemata и E.minima. Таким образом, для тотального включения стабильной изотопной метки в молекулы пептаиболов необходимо, чтобы абсолютно все ростовые субстраты были тотально меченые.

Культивирование штаммов-продуцентов проводили  на полноценных тотально 15N- или (13С+15N)-меченых средах. Коммерческие тотально (15N+13C)-меченные полноценные ростовые среды (обычно приготовляемые на основе изотопно-меченой биомассы микроводорослей) достаточно дороги. При приготовлении таких сред мы использовали автолизаты клеток и экзополисахариды облигатных метилотрофных бактерий Methylobacillus flagellatum KT, выращенных на тотально 15N- или (13С+15N)-меченой минимальной среде. Во втором случае в среду добавляли 13С-метанол в качестве единственного источника углерода. Автолизаты биомассы, охарактеризованные по их питательной ценности, использовали в таком разведении, которое являлось адекватной заменой стандартной полноценной среде на основе смеси бакто-пептона и дрожжевого экстракта. При этом вместо экзогенной глюкозы и крахмала в состав среды  вводили требуемое количество 13C,15N-меченых экзополисахаридов, синтезированных теми же метилотрофными бактериями.

Таблица 7. Состав тотально меченых полноценных ростовых сред для получения препаратов тотально меченых зервамицина IIB и антиамёбина I.

Полноценные среды

Источники азота и углерода

Дополнительный источник углерода

Стандартная среда

Бакто-пептон, дрожжевой экстракт

Крахмал, глюкоза

15N-меченая среда 

Автолизат 15N-меченой биомассы метилотрофов

Крахмал, глюкоза

(15N+13C)-меченая среда

Автолизат (15N+13C)-меченой биомассы метилотрофов

15N,13C-меченые экзополисахариды,

[U-13C]-меченая глюкоза*

* - добавляли в части экспериментов.

Наработка тотально меченой биомассы и экзополисахаридов с использованием облигатных метилотрофных бактерий Mеthylobacillus flagellatum КТ  и подбор сред для культивирования грибов-продуцентов пептаиболов проводились совместно с ГНЦ Генетики и селекции промышленных микроорганизмов (д.б.н. Д.А.Складнев).

Стандартная полноценная среда для культивирования грибов-продуцентов содержала (в расчете на на 1л): глюкозу -10г, крахмал - 10г, бакто-пептон - 10г, дрожжевой экстракт - 2,5г, CaCO3 - 8;  рН 7,2.  Культивирование грибов-продуцентов проводили на полноценной тотально (15N+13С)-меченой ростовой среде (табл. 7).  Посевную культуру выращивали в пробирках, содержащих 5мл среды, в течение 4 суток при 280С на качалке. Содержимое пробирок с выросшими мицелиальными “шариками” использовали для засева колб Эрленмейера, содержащих 1/5 объема стерильной среды.  Продолжали культивирование в тех же условиях в течение 8-10 суток.Для уменьшения риска разбавления изотопных меток посевную культуру гриба выращивали также в (15N+13С)-меченой среде. Наблюдение за ростом продуцента проводили путём ежедневного отбора проб, в которых определяли рН среды и концентрацию пептаиболов. Культивирование для наработки дважды меченых пептаиболов проводили в колбах объёмом 350мл, содержавших по 70 мл полноценной (15N+13С)-меченой среды в течение 7-8 суток. Экстракция 15N- и 13C,15N-меченых пептаиболов из мицелия гриба проводилось метанолом, а из культуральной жидкости - этилацетатом. Фракционирование полученных экстрактов и выделение тотально 15N- и 13C,15N-меченых зервамицина и антиамёбина I осуществлялось с помощью двустадийной обращенно-фазовой ВЭЖХ на колонке Vydac C-18. Применение предложенного двухстадийного биотехнологи-ческого метода для получения тотально меченых пептаиболов позволяет достичь продуктивности около 1 мг пептидного антибиотика из 1г сырого мицелия  или из 10мл культуральной жидкости, что соответствует продуктивности на полноценной среде стандартного состава. МАЛДИ-времяпролётный масс-спектрометрический анализ полученных препаратов выявил совпадение m/z молекулярных ионов и теоретически рассчитанных молекулярных масс 15N- и 13C,15N-меченых зервамицина IIB  (1857Да и 1947Да) и антиамёбина I (1687Да и 1770Да, соответственно). Степень включения метки и по азоту (15N) и по углероду (13С) составил не менее 95%.

6.2. Физико-химическое исследование пептаиболов зервамицина IIB  и антиамёбина I и модель их антимикробного действия.

Используя полученные образцы немеченых и 15N- и 13C,15N-меченых аналогов зервамицина IIB и антиамёбина I, в лаборатории биомолекулярной ЯМР–спектроскопии ИБХ РАН (рук. лаб. проф. А.С.Арсеньев) с.н.с., к.ф.-м.н. З.О.Шенкарёвым проведено физико-химическое исследование пептаиболов зервамицина IIB и антиамёбина I. Методом ЯМР-спектроскопии установлены пространственные структуры зервамицина IIB и антиамебина I в метаноле (растворитель с низкой полярностью). Молекула зервамицина (рис. 24) представляет собой правозакрученную спираль, изогнутую в районе остатка Hyp10 под углом около 43o. Спираль имеет длину около 23 ангстрем. N-концевая часть молекулы (Trp1-Leu8) представляет собой α-спираль, а С-концевая (Aib9-Phl16) –спираль, сформированную последовательностью β-изгибов, заканчивающуюся витком α-спирали. Все полярные боковые группы локализованы на выпуклой стороне спирали, а гидрофобные – на вогнутой.

Рис. 24.  Пространственная структура зервамицина IIB в  метаноле.

В случае антиамебина I C-концевой участок (Leu7-Phl16) также имеет конформацию правозакрученной спирали, сформированной последовательностью изгибов, в то время как N-концевой фрагмент (Phe1-Gly6) совершает быстрые  динамические переходы между право- и левозакрученной 310-спиральной конформацией (рис.25).

Рисунок 25. Конформационная гетерогенность антиамёбина I в метаноле. Правозакрученная (a), изогнутая (б) и левозакрученная (в) структуры петида показаны в ленточном представлении.

Поскольку метанол как растворитель с низкой полярностью не может адекватно моделировать анизотропное мембранное окружение, используя 13С,15N-меченые аналоги зервамицина IIB и антиамебина I методом гетероядерной ЯМР-спектроскопии была исследована структура и этих пептаиболов в анизотропных мембрано-моделирующих средах. Показано, что в растворе мицелл DPC С-концевая область спирали зервамицина-IIB расположена на поверхности мицеллы, а N-концевой участок пептаибола заглублён в её гидрофобную часть. Установлено, что антиамебин I имеет полностью правозакрученную спиральную конформацию в  анизотропной мембрано-моделирующей среде  - растворе бицелл DMPC/DHPC. Методом КД-спектроскопии показано, что антиамебин I имеет полностью правозакрученную спиральную конформацию в нейтральных биологических мембранах (POPC).

На основании полученных данных совместно с лабораторией биомолекулярной ЯМР-спектроскопии ИБХ РАН предложена модель, описывающая различия в механизме антимикробной активности зервамицина IIB и антиамебина I. Согласно этой модели оба пептаибола не имеют определённой конформации в водном растворе. На первом этапе происходит взаимодействие молекулы пептида с поверхностью мембраны, при этом формируется его спиральная структура, расположенная параллельно плоскости бислоя. На втором этапе N-концевая часть молекулы заглубляется в гидрофобную область мембраны и пептид переходит в трансмембранное состояние. На третьем этапе трансмембранные мономеры пептаибола агрегируют и формируют каналы из связок спиралей, через которые вытекает цитплазматическое соедержимое клетки-мишени. Исследование мембранной активности показало, что по сравнению с зервамицином IIB антиамебин I обладает как пониженным сродством к мембране, так и более низкой каналообразующей активностью в мембрано-связанном состоянии. Полученные результаты показывают, что высокая динамическая подвижность пептида затрудняет как начальное связывание антиамебина с мембраной, так и последующее образование каналов по механизму связки спиралей, и позволяют объяснить более низкую биологическую активность антиамёбина  I по сравнению с зервамицином IIB.

6.3.  Антибиотик-пептаибол  зервамицин обладает нейротропной  активностью. 

В процессе структурно-функционального исследования антибиотиков-пептаиболов нами была выявлена нейротропная активность зервамицинов IIA и IIB. Исследование влияния  зервамицинов на поведение экспериментальных животных проводилось на самцах крыс Wistar в возрасте двух месяцев.  Работа проводилась совместно с лабораторией биологических испытаний ФИБХ РАН (рук. д.б.н. А.Н.Мурашев). Все манипуляции с животными выполнялись в соответствии с протоколом, утвержденным комиссией по контролю за содержанием и использованием лабораторных животных ФИБХ РАН.

Влияние антибиотиков на поведение, в частности на локомоторную и поисковую активность крыс исследовали в тесте «Открытое поле» (ОП).  ОП представляет  собой круглую арену диаметром 80 см. Пол арены разделен на сектора, в каждом из которых имеется отверстие («норка»). При испытании животное помещали в центр арены и в течение 3 мин оценивали локомоторную активность по количеству пройденных секторов, поисковую активность по количеству подъемов на задние лапки и обследованных норок. Определяли также время грумминга, время нахождения в центре арены и количество дефекаций и уренаций. Растворы зервамицинов в 30% этиловом спирте вводили однократно  (внутрибрюшинно) в дозе 2 мг/кг массы тела животного. В качестве контроля использовали интактных животных (контроль-1) и животных, которым вводили внутрибрюшинно 30% спирт в дозе 2 мл/кг без антибиотиков (контроль-2). Исследование поведенческой активности в тесте ОП проводили через 20 и 60 минут после введения исследуемых веществ. Каждое животное подвергалось тестированию только один раз. Полученные результаты указывают на то, что исследуемые препараты зервамицинов IIA и IIB  достоверно снижают локомоторную активность крыс Wistar в тесте ОП относительно обоих контролей как через 20 минут, так и через 60 минут после введения (рис. 26). Поисковая активность экспериментальных животных (суммарное  количество стоек и обследованных норок) под влиянием 30% спирта (контроль-2) достоверно снижалась относительно интактных животных (контроль-1) через 20 минут после введения (рис. 27). Исследуемые пептаиболы также снижали поисковую активность относительно Контроля-1 через 20 и 60 минут после введения. Однако, только у животных, получавших зервамицин IIA,  наблюдали статистически значимое снижение поисковой активности относительно контроля-2 через 20 минут после введения, что может свидетельствовать как о потенцировании этим пептаиболом угнетающего  действия  30% спирта на ЦНС, так и о собственном воздействии на ЦНС. Под действием зервамицина IIA время нахождения крыс в центре площадки  увеличивалось через 20 минут после введения, что свидетельствует о понижении эмоционального возбуждения  животных под влиянием препарата, так как в первые минуты страх усиливает двигательную активность крыс в тесте ОП. На это также указывает достоверное уменьшение эмоционально-вегетативной реакции крыс (по сумме дефекаций и уренаций) под влиянием зервамицина IIA через 20 минут после введения (0,9±0,2 по сравнению c 1,7±0,3 в контроле-2; Р<0,05). Вегетативные реакции являются компонентом оборонительной реакции  животных, вызываемой страхом при помещении в незнакомую среду. Таким образом, в тесте «Открытое поле» было показано, что у крыс под действием пептаиболов зервамицинов IIА и IIB снижаются локомоторная и поисковая активности, а также  наблюдается уменьшение уровня эмоциональности и стрессируемости, что указывает на нейротропную активность исследуемых пептаиболов.

Рис. 26. Влияние пептаиболов зервамицинов IIA и IIB на локомоторную активность крыс Wistar.  # - P<0,05 по t-критерию Стьюдента относительно группы  интактных животных (контроль-1).

* - P<0,05 по t-критерию Стьюдента относительно группы животных после введения 30% этанола (контроль-2).

Рис. 27. Влияние пептаиболов Zrv-IIA и Zrv-IIB на поисковую активность крыс Wistar.  # - P<0.05 по t-критерию Стьюдента относительно группы  интактных животных (Контроль-1). * - P<0.05 по t-критерию Стьюдента относительно группы животных после введения  30% этанола (Контроль-2).

       Известно, что для нейролептиков характерно не только снижение локомоторной и исследовательской активности, но и выраженное гипотермическое действие. В следующей серии экспериментов нами было изучено влияние зермамицинов на температуру тела животных. Для измерения ректальной температуры у мышей использовали датчик «MLT1404» и компьютеризированную систему «Chart ADInstruments» (ADInstruments, СШA). Зервамицины IIA и IIB растворяли в 30% этаноле и вводили однократно  (внутрибрюшинно) в дозах 0,5 мг/кг, 2,0 мг/кг и 4,0 мг/кг массы тела животного. В качестве контроля использовали животных, которым вводили  0,9% раствор NaCl (контроль-1) или 30% этанол в объеме 2 мл/кг (контроль-2). Было показано, что зервамицины снижают температуру тела животных, что может свидетельствовать в пользу  их нейролептических свойств. Снижение температуры тела наблюдали у Zrv-IIB в дозах 2 мг/кг и 4 мг/кг, а у Zrv-IIА только в дозе 4 мг/кг.

7. Выделение и структурно-функциональное исследование новых пептидных антибиотиков бактериального происхождения.

7.1. Выделение и определение структуры новых пептидных антибиотиков латероцидина и латероцина.

Серьезные экономические и медико-социальные проблемы, вызываемые микроводорослями, определяют необходимость поиска  и разработки методов подавления их развития и прогнозирования состояния водных экосистем. Массовое увеличение численности микроводорослей  в водоёмах приводит к неблагоприятным последствиям, таким как «цветение» воды,  обрастание технологического оборудования в водных резервуарах, а также зарастание микроводорослями природных водоёмов,  водохранилищ и водных  резервуаров, обеспечивающих питьевой водой население и используемых в металлургической промышленности и  энергетике. Выделение некоторыми видами микроскопических водорослей в процессе их жизнедеятельности соединений со зловонным запахом, в частности геосмина, сильно снижает качество питьевой воды. Микроскопические водоросли, в частности, сине-зелёные водоросли (цианобактерии) продуцируют токсины, которые при гибели цианобактерий высвобождаются в водную среду. Уровень токсичности этих веществ исключительно высок. Так, микроцистин LR токсичнее цианида в 200 раз.  Токсины могут продуцироваться  и сохраняться в воде в течение нескольких недель. Они также могут накапливаться в рыбах, моллюсках, ракообразных. Концентрация токсинов, вызывающая 50%-ную гибель животных, колеблется от 15 мг/кг  до 150 мг/кг веса животных. Антидотов  к  токсинам  цианобактерий в настоящее время не выявлено. Кроме того, цианобактерии вызывают ряд аллергических заболеваний. Поэтому при высоком уровне "цветения" воды становится нежелательным использование природных водоёмов для купания.  Концентрация  токсина микроцистина в природных водоёмах не должна превышать 20 мкг/л.

Наиболее перспективным способом подавления развития микроводорослей  в водной среде является применение биологических средств на основе бактерий и их метаболитов, обладающих альгицидными свойствами. Штаммы грам-положительных спорообразующих бактерий Brevibacillus laterosporus  ВКПМ В-8287 и ВКПМ B-10531, обладающие активностью против микроскопических водорослей, были выделены и идентифицированы  во ФГУН ГНИИ генетики и селекции промышленных микроорганизмов (д.б.н. Р.Р.Азизбекян).

       Из штаммов Brevibacillus laterosporus  ВКПМ В-8287 и ВКПМ B-10531 были выделены цианолитические соединения, названные латероцидином и латероцином, соответственно. С целью выделения пептидных антибиотиков каждый из штаммов  Brevibacillus laterosporus культивировали  в  жидкой питательной  среде NBY. Культуральную жидкость центрифугировали, полученную надосадочную жидкость отбрасывали, а  к  осадку добавляли абсолютный этанол. Спиртовую экстракцию продолжали в течение 20 часов при комнатной температуре. Полученный спиртовой  экстракт отделяли центрифугированием,  раствор упаривали досуха, а осадок  переастворяли в этаноле. Раствор фракционировали  с  помощью двухстадийной обращенно-фазовой ВЭЖХ на  колонках Delta Pak C-18 и  Vydac C-18 в  линейном градиенте ацетонитрила. Фракции, проявляющие  антибактериальную активность, объединяли  и упаривали  досуха. Для  определения  молекулярной  массы латероцидина использовали  масс-спектрометрический  анализ на масс-спектрометре VISION 2000 (ThermoBioAnalysis). Для определения первичной структуры выделенных  антибиотиков применяли ЯМР-спектроскопию. ЯМР-спектры выделенных пептидных антибиотиков в метаноле были получены  в лаборатории биомолекулярной ЯМР-спектроскопии ИБХ РАН. На основании анализа 1Н-ЯМР спектров проведено полное отнесение сигналов  протонов исследуемых образцов, которое соответствует аминокислотным последовательностям:

Латероцидин (молекулярная  масса  1224,4 Да)

[cyclo-(L-Val-L-Orn-L-Leu-D-Tyr-L-Pro-L-Phe-D-Phe-L-Asn-L-Asp-L-Leu)]

Латероцин (молекулярная масса 1240,6 Да)

[cyclo-(L-Val-L-Orn-L-Leu-D-Tyr-L-Pro-L-Phe-D-Phe-L-Asn-L-Asp-L-Met-)]

Анализ баз данных по аминокислотным последовательностям показал, что приведенные выше структуры не описаны ранее, а выделенные нами циклодекапептиды являются новыми пептидными антибиотиками. Выделенные пептиды, названный нами  латероцидином и латероцином,  относятся  к  семейству  тироцидиновых  антибиотиков. Интерес к этому классу пептидных антибиотиков существенно возрос в последние годы в связи с обнаружением их высокой эффективности против возбудителей малярии – паразитических простейших рода Plasmodium (свыше 90 % случаев — Plasmodium falciparum). В настоящее время возбудители малярии ежегодно инфицируют более 300 миллионов человек, в подавляющем большинстве случаев – детей раннего возраста.

7.2. Поиск и структурно-фукциональное изучение новых лантибиотиков. 

Одним из самых перспективных направлений поиска новых пептидных антибиотиков является изучение метаболитов с антибиотической активностью из грам-положительных бактерий. Особое внимание уделяется исследованиям бактерий рода Bacillus -  грам-положительным спорообразующим аэробам, повсеместно встречающимся в живой природе. Представители данного рода в большей части своей непатогенны для человека и животных и  в течение десятилетий успешно используются в народном хозяйстве. Так, например, низин, вырабатываемый культурами молочнокислых бактерий Lactococcus lactis, уже более 40 лет широко используется в пищевой промышленности в качестве  консерванта в таких процессах, как обработка мясных и молочных продуктов, изготовление сыра, консервация фруктовых напитков, пива,  вина и т.д. Ежегодная продукция низина в мире достигает нескольких тысяч тонн.  В 1988 г. FDA (US Food & Drug Administration - Управление по контролю качества лекарственных препаратов, пищевых продуктов и косметических средств США) присвоило низину статус  GRAS (Generally Recognized as Safe – общепризнан как безопасный).  Низин также входит в список пищевых добавок, разрешенных к применению в пищевой промышленности в  Российской  Федерации (код Е234).

7.2.1. Поиск и выделение новых лантибиотиков из  штамма  Bacillus licheniformis VK21.

Bacillus licheniformis – грам-положительная аэробная термофильная (терморезистентная) бактерия,  обитающая в верхний слоях почвы. Bacillus licheniformis является антагонистом патогенной и условно-патогенной микрофлоры, подавляет рост стафилококков, стрептококков, сальмонелл, дрожжевых грибков. Нами было показано, что штамм термофильных бактерий Bacillus lichenoformis VK21 продуцирует пептиды, проявляющие выраженную антимикробную активность в отношение широкого круга микроорганизмов.

Лантибиотики – пептидные антибиотики, синтезируемые на рибосомах и содержащие нетривиальные аминокислоты, образующиеся в результате пострансляционных модификаций остатков серина и треонина (Dha, 2,3-дидегидроаланин; Dhb,  2,3-дидегидроаминомасляная кислота;  Lan, лантионин; MeLan,  3-метиллантионин).  Тиоэфирные связи в структуре остатков Lan и MeLan, формируемые в результате взаимодействия пространственно сближенных остатков цистеина и Dha или Dhb, играют ключевую роль в проявлении антибактериальных свойств лантибиотиков.

Различия в путях биосинтеза лантибиотиков позволяют разделить их на две группы. Для представителей I группы (низин, эпидермин, субтилин, Pep5) характерно участие в биосинтезе двух ферментов (дегидратазы LanB и циклазы LanC), осуществляющих  потсрансляционные реакции дегидратации и образования тиоэфирной связи, соответственно. Лидерный участок предшественников таких лантибиотиков отщепляется сериновой протеазой LanP. Ко II группе принадлежат лантибиотики цитолизин, лактицин 481 и  мерсацидин, пострансляционные модификации в которых осуществляются одним ферментом LanM.

Одним из самых перпективных направлений изучения свойств лантибиотиков является поиск и изучение новых двухкомпонентных систем. Наличие таких систем  выявлено у некоторых бактерий, способных вырабатывать два различных по строению лантибиотика, обладающих синергическим действием.  В настоящее время известно всего шесть двухкомпонентных лантибиотиков,  включая стафилококцин C55 из Staphylococcus aureus C55; лактицин 3147, Ltn и Ltn из  Lactococcus lactis DPC3147; плантарицин W из Lactobacillus plantarum; SmbA и SmbB из мутантных штаммов Streptococcus GS5; BHT-A из Streptococcus rattus BHT; галодурацин, Hal и Hal из Bacillus halodurans C-125. Большинство из известных двухкомпонентных лантибиотиков охарактеризовано только на уровне нуклеотидной последовательности предшественников пептидов. До настоящего времени полные химические структуры зрелых пептидов  установлены только для двух пар лантибиотиков (лактицин 3147, Ltn и  Ltn;  галодурацин, Hal и Hal). Кластер генов, предположительно кодирующий  двухкомпонентную систему лантибиотиков, был обнаружен ранее в двух штаммах Bacillus lichenifirmis, ATTC14580 и DSM13, включая два структурных гена (ATTC14580: bliA1 и  bliA2; DSM13: licA1 и  licA2). Соответствующие им двухкомпонентные системы (пептиды Bli и Bli, Lic и Lic) были только частично охарактеризованы (Begley M. et al., 2009; Dischinger J. et al., 2009). 

7.2.2. Амплификация и определение нуклеотидной последовательности кластера генов лантибиотиков в геноме  Bacillus licheniformis VK21. 

Нами была определена нукледотидная последовательность кластера генов лантибиотиков в геноме  Bacillus licheniformis VK21,  включая структурные гены lchA1 и lchA2, кодирующие предшественники лантибиотиков, и гены модифицирующих их ферментов lchM1 и lchM2. Для амплификации фрагментов генома Bacillus licheniformis VK21, содержащих гены предшественников лантибиотиков и ферментов, осуществляющих посттрансляционные модификации данных предшественников были сконструированы ген-специфичные праймеры на основе известной нуклеотидной последовательности генов lanA1, lanA2 и lanM1 из  бактерии Bacillus licheniformis штамма АТСС14580.  Для амплификации участка, кодирующего предшественники зрелых пептидов,  была проведена «гнездовая» ПЦР с целью предотвращения амплификации неспецифических продуктов.  В первой реакции в качестве матрицы использовалась геномная ДНК B. licheniformis VK21, во второй – продукты первой реакции в разведении 1:20. Полученные на каждом этапе продукты фракционировали в агарозном геле, фрагменты требуемой длины выделяли с помощью набора «Zymoclean Gel DNA Recovery Kit» (Zymo Research). Нуклеотидная последовательность определялась секвенированием по Сэнгеру в двух направлениях. Продукты генов предшественников лантибиотиков LchA1и LchA2 состоят из 74 и 72 аминокислотных остатков, соответственно.В структуре предшественников лантибиотков LchA1 и LchA2 можно выделить две функциональные части: N-концевые лидерные части, обогащенные заряженными аминокислотными остатками, и С-концевые гидрофобные последовательности самих пропептидов (рис. 28). В состав лидерных частей обоих пептидов входят сайты расщепления Gly-Gly. В аминокислотной последовательности предшественника LchA2 присутствует дополнительный сайт расщепления, состоящий из шести аминокислотных остатков, находящийся после сайта Gly-Gly. Нуклеотидная последовательность гена депонирована в базе данных GeneBank под регистрационным номером GU949560.

7.2.3. Оптимизация условий культивирования термофильных бактерий  Bасillus licheniformis VK21 и выделение индивидуальных лантибиотиков Lchα и Lchβ.

Культуру Bacillus licheniformis VK21 выращивали  на LB-агаре при 45С в течение 16 часов. Культивирование проводили в среде С2Mn при температуре 45С  и 220 об/мин в течение 6 часов до выхода культуры на стационарную фазу роста. Культуральную жидкость центрифугировали в течение 50 мин при 8000g. Супернатант концентрировали в 20 раз. Для удаления высокомолекулярных соединений к полученному раствору добавляли двойной объем ацетона, центрифугировали в течение 40 мин при 8000g.

 

Рис. 28. Структура кластера генов лантибиотиков в геноме  Bacillus licheniformis VK21 и сравнение аминокислотных последовательностей предшественников лантибиотиков LchA1 и LchA2 с пропептидами других лантибиотиков. (А) Кластер генов двухкомпонентного лантибиотика лихеницидина VK21. (Б,В)  Сравнение аминоксилотных последовательностей  предшественников лантибиотиков LchA1 и LchA2 с пропептидами лантибиотиков: галодурацина,  HalA1 и HalA2; плантарицина W, PlwA1 и PlwA2; SmbA1 (обозначенного авторами как SmbB) и SmbA2 (обозначенного авторами как SmbA); Bht, BhtA1 и BhtA2; лактицина 3147, LtnA1 и  LtnA2; стафилококцина C55, SacA1 и  SacA2; мерсацидина, Mrs. остатки Ser/Thr, посттрансляционно модифицированные до D-Ala/Obu, выделены  зелёным/жёлтым цветами. Другие остатки Ser/Thr выделены бирюзовым цветом, а немодифицрованные остатки подчеркнуты. Остатки Cys показаны малиновым цветом. Тиоэфирные и дисульфидные связи отмечены стрелками и выделены серым фоном. Тиоэфирные кольца в зрелых пептидах Lch и Lch отмечены латинскими буквами A,B,C,D. Наиболее вероятный сайт расщепления протеазой LchT показан красным цветом. (Г) Химические структуры посттрансляционно модифицированных аминокиcлотных остатков. 1. Остаток 2-оксомасляной кислоты. 2. R1=H, остаток 2,3-дидегидроаланина или Dha (U); R1=CH3, остаток 2,3-дидегидробутирина или Dhb (О). 3. R2=H, остатки лантионина или Ala-S-Ala (Lan); R2=CH3, 3-метиллантионин или Abu-S-Ala (MeLan).

Супернатант упаривали на роторно-вакуумном испарителе и перерастворяли в воде, после чего проводили экстракцию n-бутанолом. n-Бутанольную фракцию упаривали на роторно-вакуумном испарителе, осадок перерастворяли и наносили на колонку Silasorb C8. Элюент растворяли в 30мМ ацетате аммония до достижения концентрации ацетонитрила в нем 30% и наносили на колонку Диасорб 130С8-Т. Дальнейшее разделение проводили с помощью двухстадийной  обращенно-фазовой ВЭЖХ (рис. 29).

Наличие целевых пептидов  во фракциях устанавливали с помощью теста на антимикробную активность. Выделенные пептиды исследовали методом масс-спектрометрии. Масс-спектры были получены на MALDI-времяпролетном масс-спектрометре Reflex III BRUKER. Таким образом, из культуральной жидкости термофильной бактерии Bacillus licheniformis VK21 было выделено два новых пептидных антибиотика с молекулярной массой  3249,51 Да и 3019,36 Да, названных Lchα и Lchβ. 

Рис. 29. Выделение Lch и Lch с помощью обращенно-фазовой ВЭЖХ. (A) Фракционирование грубого экстракта лихеницидина VK21 методом обращенно-фазовой ВЭЖХ на колонке  Diasorb-130C8T в линейном градиенте ацетонитирила от 30% до 80%. Фракции 1 и 2, проявившие биологическую активность  в отношение M. luteus и  B. megaterium, заштрихованы. (Б,В) Разделение полученных фракций 1 (Б) и 2 (В) с помощью обращенно-фазовой ВЭЖХ на колонке  Diaspher-110-C4 в линейном градиентк ацетонитрила от 5% до 35%. Активные фракции, содержашие Lch и Lch, заштрихованы. (Г,Д) ВЭЖХ индивидуальных пептидов  Lch  (Г) и  Lch (Д).

7.2.4. Антимикробная активность выделенных пептидов  Lchα и Lchβ.

Сравнительное исследование антимикробной активности индивидуальных лантибиотиков Lchα и Lchβ и их смесей проводилось с целью выявления  их оптимального соотношения для проявления синергизма антибиотического действия. Был определен спектр антимикробной активности и минимальные ингибирующие концентрации в отношение ряда тест-культур. Для определения антимикробной активности в качестве тест-культур использовали бактерии  Bacillus subtilis, штамм L1; Rhodococcus sp., штамм SS2; Micrococcus luteus, штамм B1314; Pseudomonas aeruginosa, штамм PAO1; Pseudomonas putida, штамм I-97.  Перечисленные штаммы бактерий были получены из коллекции Института биохимии и физиологии микроорганизмов РАН. Штамм Escherichia coli C600 был получен ихз коллекции Филиала Института биоорагнической химии РАН (Пущино). Штамм Bacillus megaterium VKM41 был получен их Всероссийскйо коллекции микроорганизмов (Пущино). Штамм Staphylococcus aureus 209p был получен из Кубанской государственной медицинской академии (Краснодар). Бактерии Bacillus pumilus, штамм 2001; Bacillus globigii, штамм I; Bacillus amyloliquefaciens, штамм I; Mycobacterium smegmatis, штамм 1171; Mycobacterium phlei, штамм 1291 были получены из  ГНУ НИИ пушного звероводства и кролиководства имени В.А.Афанасьева (Родники, Московская область). Количественную оценку антибактериальной активности пептидов определяли методом двукратных серийных разведений в жидкой питательной среде в 96-луночных плашках. Результаты тестов приведены в таблице 8. IC50 определялась как концентрация пептида, необходимая для ингибирования роста тест-культуры на 50%. Значение MIC соответствовало минимальной концентрации пептида, полностью подавляющей рост тест-культуры при инкубации в течение ночи.

Таблица 8. Антимикробная активность лихеницидина VK21 и индивидуальных пептидов Lch and Lch.

Пептиды

Концентрация, M

B. megaterium

B. subtilis

M. luteus

Rhodococcus sp.

S. aureus

Lch

IC50

1.8

9

1.2

9

3.1

MIC

7.2

15

> 4.8

> 15

18.4

MBC

10.8

> 36

н.о.

Н.о.

> 46.1

MBC

MIC

1.5

н.о.

н.о.

Н.о.

> 2.5

Lch

IC50

2

30

2.6

16.6

20

MIC

12

> 50

> 5.3

> 16.6

50

MBC

> 12

н.о.

н.о.

Н.о.

н.о.

MBC

MIC

н.о.

н.о.

н.о.

н.о.

н.о.

Lch +

Lch

IC50

0.12

0.64

0.09

0.64

0.64

MIC

0.48

0.96

0.17

> 2.56

0.96

MBC

0.96

3.84

1.92

н.о.

> 4.8

MBC

MIC

2

4

11

н.о.

> 5

н.о. – не определяли

MBC определялось с помощью внесения 110 мкл культуры из каждой лунки, где не наблюдался рост тест-культуры при определении MIC, на LB-агар и дальнейшей инкубации культуры в течение ночи. MBC соответствало минимальной концентрации пептида, предотвращающей рост тест-культуры на поверхности LB-агара после инкубации в течении ночи  и приводящей к подавлению  >99,9% CFU по сравнению с контролем. 

При тестировании смеси Lchα и Lchβ было установлено синергическое действие  индивидуальных пептидов  против грам-положительных бактерий в наномолярном диапазоне концентраций. Хотя антимикробная активность индивидуальных пептидов  Lch  и Lch проявляется в микромолярных концентрациях, их смесь в соотношении 1:1 вызывает  от 20- до 50-кратного повышения активности в зависимости от тест-культуры по сравнению с активностью индивидуальных пептидов. На некоторых тест-культурах смесь пептидов активна даже в наномолярных концентрациях. Наряду с этим, ни индивидуальные пептиды, ни их смесь не обладали  актиностью против  грам-отрицательных бактерий. Исследована антимикробная активность смеси  Lch  и Lch  при различных концентрациях индивиудальных пептидов и их молярных соотношениях (рис. 30). Показано, что смесь Lch  и Lch наиболее активна при молярном соотношении индивидуальных пептидов 1:1 (рис. 30Е).. 

Рис. 30 (А-Д) Антимикробная активность Lch  и Lch (в соотношении 1:1) в различных концентрациях против грам-положительных бактерий. (о) Контроль в отсутствие пептидов.

(Е) Эффект смеси  Lch  и Lch на рост Bacillus megaterium VKM41 при различніх соотношениях пептидов и различных концентрациях, показанных белым  (0,36 M), серым (0,24 M) и черным  (0,12 M) цветами. 

Таким образом, установлено, что лихеницидин является новым двухкомпонентным лантибиотиком, индивиуальные компоненты которого обладают синергическим действием.

7.2.5. Определение структуры  выделенных пептидов Lch и Lch.

Структура выделенных пептидов Lch и Lch были установлены совместно с лабораторией биомолекулярной ЯМР-спектроскопии ИБХ РАН (к.ф.-м.н. З.О.Шенкарёв,  рук. д.х.н. А.С.Арсеньев) с применением методов ЯМР-спектроскопии и масс-спектрометрии. Установлено, что каждый пептид содержит 31 аминокислотный остаток, 4 внутримолекулярных тиоэфирных связи и N-концевой остаток 2-оксомасляной кислоты (рис. 31).

Рис. 31. Сравнение структур лихеницидинов Lch и Lch с другими лантибиотиками. (А,Б) Первчиные структуры и предполагаемый механизм созревания пептидов Lch и Lch. (В) Первичные структуры других лантибиотиков. Домены, связывающие липид II, обведены зеленым цветом. Положительно и отрицательно заряженные остатки показаны голубым и красным цветами, соответственно. 

Пространственная структура Lch и Lch была установлена методом ЯМР-спектроскопии в растворе метанола. Lch проявляет черты структурной гомологии с мерсацидин-подобными лантибиотиками и содержит относительно хорошо структурированные  N- и C-концевые домены, связанные между собой подвижной петлей, стабилизированной тиоэфирной связью Ala11-S-Ala21. Напротив,  Lch представляет собой вытянутую гидрофобную -спираль фланкированную более подвижными N- и  C-концевыми доменами (рис. 32).

Рис. 32. Пространственные структуры лихеницидинов Lch и Lch в метаноле.

7.2.6. Модель антимикробного  действия лихеницидина.

Выделенные нами из B. licheniformis VK21  пептиды Lch и Lch принадлежат к группе двукомпонентных лантибиотиков. Они  способны ингибировать рост широкого числа грам-положительных бактерий, таких как Staphylococcus aureus, Bacillus megaterium,  Micrococcus luteus, Bacillus subtilis.  Антибактериальная активность смеси этих пептидов проявляется в наномолярных концентрациях.  С целью построения модели антибиотического действия выделенных пептидов было проведено сравнение структурно-функциональных характеристик  пептидов из термофильных бактерий  Bасillus licheniformis со свойствами других лантибиотиков.

На основании сходства пространственной структуры лантибиотики подразделяются на две группы. К первой группе относятся лантибиотики, формирующие поры в клеточной мембране клеток-мишеней (низин, Pep5, эпидермин). Ко второй группе  относят пептиды, механизм действия которых связан с нарушением процесса биосинтеза клеточной стенки (циннамицин, дурамицин,  мерсацидин). Современная концепция молекулярного механизма антимикробного действия  двухкомпонентных лантибиотиков включает представления о многостадийном процессе, результатом которого является порообразование в мембране и гибель клетки-мишени. На первой стадии этого процесса -компонент селективно связывается с липидом II клеточной стенки бактерии. Второй этап процесса заключается в селективном связывании -компонента, представляющего собой вытянутую спираль,  с образовавшимся комплексом  -компонент/липид II в соотношении 1:1. В лантибиотиках идентифицированы два типа мотивов, связывающих липид II.  Один их них обнаружен в низине и низин-подобных пептидах (галлидермин, эпидермин, мутацин 1140, субтилин). Взаимодействие этого мотива с липидом II препятствует дальнейшему вовлечению последнего в биосинтез клеточной стенки. Второй тип  липид II-связывающего мотива был обнаружен в мерсацидине и мерсацидинхподобных лантибиотиках (плантарицин С, лактицин 481,  -компоненты лактицина 3147 и галодурацина). Образование комплекса с липидом II в этом случае ингибирует реакцию трансгликозилирования в процессе биосинтеза пептидогликана.

Полученные в рамках данной работы структурные данные позволяют предложить модель антимикробного  действия лихеницидинов. Lchα проявляет черты структурного сходства с мерсацидин-подобными лантибиотиками и низином А в участках, ответственных за связывание с липидом II клеточной стенки бактерий, что позволяет высказать предположение об аналогичном механизме антимикробного действия лихеницидина.  Вероятнее всего, Lch образует комплекс с липидом II с участием одного или двух предполагаемых сайтов связывания (низин-подобным и/или мерсацидин-подобным).  Последующее вовлечение  Lch во взаимодействие с этим комплексом в соотношении 1:1, по-видимому, может опосредовать его внедрение в мембрану, что приводит к образованию пор. Эта модель подтверждается рядом экспериментальных данных. Во-первых,  смесь Lch+Lch проявляет антимикробную активность в наномолярном диапазоне концентраций, что свидетельствует о наличии специфической молекулярной мишени на мембране клетки. Структурное сходство липид II-связывающих мотивов Lch и других лантибиотиков указывпает на липид  II как на наиболее вероятную мишень для связывания с Lch. Центральный домен Lch представляет собой протяженную спираль длиной около 23 ангсрем, что достаточно для пронизывания липидного бислоя.  Предложенная модель хорошо согласуется с данными о синергическом действии Lch и Lch, максимальный эффект  от которого достигается при соотношении индивидуальных пептидов 1:1. Полученные данные позволяют объяснить более слабую активность индивидуальных пептидов. Скорее всего, взаимодействие индивидуального Lch и липида II ингибирует биосинтез пептидогликана, а катионный сам по себе Lch может связываться с анионными липидами мембраны бактериальной клетки и приводить к образованию пор по аналогии с механизмом действия низина  в отсутствие липида II.

       

ВЫВОДЫ

1. Установлена первичная структура новых антимикробных пептидов ареницинов из целомоцитов морского кольчатого червя Arenicola marina. Определены полные  нуклеотидные последовательности кДНК, кодирующих белки-предшественники ареницинов, и соответствующие им  аминокислотные последовательности препроареницинов. Показано, что ареницины не обладают структурной гомологией ни с одним из ранее известных антимикробных пептидов и могут быть названы первыми представителями нового семейства  пептидных антибиотиков.  В то же время,  последовательности продоменов предшественников ареницинов обладают гомологией со структурой  предшественников хондромодулинов позвоночных в области домена BRICHOS. Показано, что ареницины  обладают широким спектром микробицидного, в том числе антибактериального  и противогрибкового действия.

2. Сконструированы биотехнологические системы для гетерологичной экспрессии ареницина в E. coli в составе различных гибридных белков. Получен  штамм-продуцент, позволяющий экспрессировать гибридный белкок, содержащий ареницин. Разработан способ получения, методика выделения и очистки  рекомбинантного ареницина,  полностью идентичного природному пептидному антибиотику, а также его аналогов, меченных стабильными изотопами 15N и 13C. С использованием полученных рекомбинантных аналогов изучены физико-химические свойства рекомбинантного ареницина. На основании полученных данных  предложена модель, описывающая механизм антимикробной активности пептида.

3. Установлена  первичная структура нового антимикробного пептида аурелина из мезоглеи сцифоидной  медузы Aurelia aurita.  Определена  полная  нуклеотидная последовательность кДНК, кодирующую белок-предшественник аурелина, и соответствующая ей полную аминокислотную последовательность препроаурелина. Проанализированы структурные особенности аурелина и его предшественника в сравнении с другими антимикробными пептидами беспозвоночных Показано, что аурелин является новым пептидом, не обладающим существенной гомологией ни с одним из известных ранее антимикробных пептидов. В то же время, обнаружены  некоторые черты  его структурного сходства с антимиробными пептидами дефенсинами и токсинами морских анемон, блокаторами  калий-селективных каналов, что может быть следствием их дивергентной эволюции от общего предшественника. Установлено, что аурелин обладает антибактериальным  и противогрибковым действием.

4. Сконструирована биотехнологическая система для гетерологичной экспрессии аурелина в E. coli в составе гибридного белка. Получен штамм-продуцент, позволяющий экспрессировать гибридный белок, содержащий аурелин. Разработан способ получения, методика выделения и очистки  рекомбинантного аурелина,  полностью идентичного природному пептидному антибиотику, а также его аналогов, меченного стабильным изотопом 15N.  С использованием полученных рекомбинантных аналогов аурелина изучены физико-химические свойства пептида. На основании полученных данных высказано предположение о том, что мембранная активность аурелина лежит в основе его антимикробного действия.

5. Сконструирована биотехнологическая система для гетерологичной экспрессии в клеках E. coli.буфорина, антимикробного пептида из желудка азиатской жабы Bufo bufo gargarizans.  Получен штамм-продуцент, позволяющий экспрессировать с высоким выходом гибридный белок, содержащий буфорин. Разработан способ получения, методика выделения и очистки генно-инженерного буфорина, позволяющий получать рекомбинантный пептидный антибиотик, полностью идентичный природному по молекулярной массе, аминокислотной последовательности и антимикробной активности.

6. Выделен новый дефенсин из семян чечевицы Lens culinaris и установлена его структура. Определена полная последовательность кДНК, кодирующая  белок-предшественник дефенсина чечевицы, и соответствующая ему  полная аминокислотная последовательность. Установлено, что дефенсин чечвицы обладает активностью против фитопатогенных грибов. Проведен сравнительный анализ структурных и биологических характеристик  нового дефенсина и ранее известных дефенсинов бобовых растений. 

7. Сконструирована биотехнологическая система для гетерологичной экспрессии дефенсина чечевицы в клеках E. coli.  Получен штамм-продуцент, позволяющий экспрессировать гибридный белок, содержащий дефенсин чечевицы. Разработан способ получения, методика выделения и очистки генно-инженерного дефенсина, позволяющий получать рекомбинантный антимикробный пептид,  полностью идентичный природному пептидному антибиотику, а также его аналога, меченного стабильным изотопом 15N. С использованием полученных рекомбинантных аналогов дефенсина чечевицы изучены физико-химические свойства пептида,  показано сходство структур дефенсина чечевицы и  других растительных дефенсинов.

8. В семенах чечевицы Lens culinaris обнаружено восемь новых липид-транспортирующих белков. Разработана методика выделения и установлена структура четырех липид-транспортирующих белков из семян чечевицы Lens culinaris.Установлены структуры полноразмерных кДНК, кодирующих белки-предшественники шести изоформ липид-транспортирующих белков из семян чечевицы Lens culinaris, и соответствующие им полные аминокислотные последовательности. Показано, что липид-транспортирующие белки чечевицы обладают антибактериальной активностью и ингибируют рост фитопатогенных грибов.

9. Сконструирована биотехнологическая система для гетерологичной экспрессии в клеках E. coli липид-транспортирующего белка Lc-LTP2 из семян чечевицы Lens culinaris.  Получен штамм-продуцент, позволяющий экспрессировать гибридный белок, содержащий липид-транспортирующий белок чечевицы. Разработан способ получения, методика выделения и очистки генно-инженерного липид-транспортирующего белка, позволяющие получить рекомбинантный антимикробный пептид,  полностью идентичный природному липид-транспортирующему белку, а также его аналог, меченный стабильным изотопом 15N. С использованием полученных рекомбинантных аналогов липид-транспортирующего  белка чечевицы изучены физико-химические свойства пептида,  показано сходство структур Lc-LTP2 и  других растительных липид-транспортирующих белков. Установлено, что липид-транспортирующий белок чечевицы Lc-LTP2 является новым пищевым аллергеном. Lc-LTP2 внесен в международную базу данных по аллергенам как Len c 3.

10. Разработаны методики выделения  и  очистки  антимикробных пептидов зервамицина IIB и антиамебина I из мицелиальных  спорообразующих грибов Emericellopsis salmocynnemata и Emericellopsis minima, соответственно, а также биотехнологический способ получения их аналогов, меченных стабильными изотопами 13С и 15N. Используя 13С,15N-меченые аналоги зервамицина IIB и антиамебина I изучены физико-химические свойства пептаиболов в мембрано-моделирующих средах. На основании полученных данных предложена модель, описывающая различия в механизмах действия зервамицина и антиамебина. Выявлена нейротропная активность зервамицинов,  изучено их влияние на локомоторную и поисковую активность, а также  на температуру тела лабораторных животных. 

11. Выделены новые антимикробные пептиды латероцидин и латероцин из штаммов аэробных грам-положительных бактерий  Brevibасillus laterosporus  ВКПМ  В-8287 и ВКПМ B-10531, соответственно, и установлена их первичная структура.

12. Выделен новый двухкомпонентный лантибиотик лихеницидин из штамма термофильных грам-положительных бактерий  Bacillus lichenifromis VK21 и  установлена структура его компонентов. Проанализированы структурные особенности лихеницидина в сравнении с другими лантибиотиками. Изучен спектр антибактериальной активности лихеницидина и исследован синергизм антимикробного действия его компонентов. Предложена модель, описывающая механизм антимикробной активности двухкомпонентного лантибиотика лихеницидина. 

Список опубликованных работ по теме диссертации

Статьи

1. Z.O.Shenkarev, S.V.Balandin, K.I.Trunov, A.S.Paramonov, S.V.Sukhanov, L.I.Barsukov, A.S.Arseniev, T.V.Ovchinnikova. Molecular Mechanism of Action of -Hairpin Antimicrobial Peptide Arenicin: Oligomeric Structure in DPC Micelles and Pore Formation in Planar Lipid Bilayers // Biochemistry (USA). -  2011. - Jun 1. [Epub ahead of print]. DOI: 10.1021/bi200746t

2. E.S.Salnikov, C.Aisenbrey, S.V.Balandin, M.N.Zhmak, T.V.Ovchinnikova, B.Bechinger. Structure and alignment of the membrane-associated antimicrobial peptide arenicin by oriented 15N and 31P solid-state NMR spectroscopy // Biochemisrty (USA). – 2011. -  V.50. -  P.3784-3795. 

3. R.Mach,  M.Hof, T.Chernovets, M.N.Zhmak, T.V.Ovchinnikova, J.Sykora. Formation of arenicin-1 clusters in bilayers and their specific lipid interaction revealed by z-scan FCS // Analytical & Bioanalytical Chemistry. -  2011. – V.399. – P.3547-3554.

4. Novgorodov S.A., Wu B.X., Gudz T.I., Bielwaski J., Ovchinnikova T.V., Hannun Y.A., Obeid L.M. Novel pathway of ceramide production in mitochondria: thioesterase and neutral ceramidase produce ceramide from sphingosine and acyl-COA // J. Biol. Chem. -  2011. – V. 

5. Z.O.Shenkarev, E.I.Finkina, E.K.Nurmukhamedova, S.V.Balandin, K.S.Mineev, K.D. Nadezhdin, Z.A.Yakimenko, A.A.Tagaev, Y.V.Temirov, A.S.Arseniev, T.V.Ovchinnikova. Isolation, structure elucidation, and synergistic antibacterial activity of a novel two-component lantibiotic lichenicidin from Bacillus licheniformis VK21 // Biochemistry (USA). – 2010. -  V.49. - P.6462-6472.

6. Stavrakoudis A., Tsoulos I.G., Shenkarev Z.O., Ovchinnikova T.V. Molecular dynamics simulation of antimicrobial peptide arenicin-2: -hairpin stabilization by noncovalent interactions // Biopolymers. – 2009. – V.92. – No.3. – P.143-155.

7. Stegemann C., Kolobov A., Leonova Yu.F., Shamova O., Ovchinnikova T.V., Kokryakov V.N., R.Hoffmann R. Isolation, purification and de novo sequencing of TBD-1, the first beta-defensin isolated from reptiles //  Proteomics. – 2009. –V.9. -  No.5. - P.1364-1373.

8. A. D. Milov, R. I. Samoilova, A. A. Shubin, E.Yu. Gorbunova, L.G. Mustaeva, Т.V. Ovchinnikova, J. Raap,  Yu. D. Tsvetkov. Self-Aggregation and orientation of the ion-Channel forming zervamicin IIA in the membranes of ePC vesicles studied by cw EPR and ESEEM spectroscopy // Appl. Magnetic Reson.- 2009. - V.39. -  P.75-84.

9. Шенкарев З.О., Люкманова Е.Н., Соложенкин О.И., Гагнидзе И..Э, Некрасова О.В., Чупин В.В., Тагаев А.А., Якименко З.А., Овчинникова Т.В., Кирпичников В.П., Арсеньев А.С. Липид-белковые нанодиски: возможность применения для ЯМР-исследований мембранных белков и мембрано-активных пептидов // Биохимия. -  2009. - Т.74. -  Вып. 7. -  С.933-945.

10. Ovchinnikova T.V., Shenkarev Z.O., Balandin S.V., Nadezhdin K.D., Paramonov A.S.,  Kokryakov  V.N.,  Arseniev A.S. Molecular insight into mechanism of antimicrobial action of the  -hairpin  peptide arenicin:  specific  oligomerization  in detergent micelles //  Biopolymers. – 2008. – V.89. – P.455-464.

11.  Finkina E.I., Shramova E.I., Tagaev A.A., Ovchinnikova T.V. A  novel defensin from the lentil Lens culinaris  seeds // Biochem. Biophys. Res. Commun. -  2008. - V. 371. - No. 4. -  P. 860-865.

12. Lyukmanova E.N., Shenkarev Z.O., Paramonov A.S., Sobol A.G., Ovchinnikova T.V., Chupin V.A., Kirpichnikov M.P., Blommers M.J.J., Arseniev A.S. Lipid-protein nanscale bilayers: a versatile medium for NMR investigations of membrane protein and membrane-active-peptides // J. Am. Chem. Soc. – 2008. – V. 130. – P.2140-2141.

13.  Дьяченко И.А., Мурашев А.Н., Овчинникова Т.В. Особенности нейротропной активности зервамицинов IIA и IIB // Доклады Академии наук. – 2008. - Т.419. -  №.3. - С.403-405.  

14. Дьяченко И.А., Мурашев А.Н., Овчинникова Т.В. Исследование нейротоксичности пептаиболов зервамицинов // Токсикологический вестник. – 2008. - Т.3. - С.35-38.

15. Ovchinnikova T.V., Shenkarev Z.O., Nadezhdin K.D., Balandin S.V., Zhmak M.N., Kudelina I.A.,  Finkina E.I., Kokryakov V.N., Arseniev A.S. Recombinant expression, synthesis, purification, and solution structure  of arenicin // Biochem. Biophys. Res. Commun. – 2007. - V.360. - No.1. – P.156-162.

16. Овчинникова Т.В., Мурашев А.Н. Антибиотик-пептаибол зарвамицин обладает нейротропной активностью // Доклады Академии наук. – 2007. - Т.414. - №5. - С.707-709.

17. Ovchinnikova T.V., Levitskaya N.G., Voskresenskaya O.G., Yakimenko Z.A., Tagaev A.A., Ovchinnikova A.Yu., Murashev A.N., Kamenskii A.A. Neuroleptic properties of the ion channel-forming peptaibol zervamicin: locomotor activity and behavioral effects // Chemistry and Biodiversity. -  2007. - V.4. – No.6. – P.1374-1387.

18. Shenkarev Z.O., Paramonov A.S., Nadezhdin K.D., Bocharov E.V., Kudelina I.A., Skladnev D.A., Tagaev A.A., Yakimenko Z.A., Ovchinnikova T.V., Arseniev A.S. Antiamoebin-I in methanol solution: rapid exchange between right-handed and left-handed 310-helical conformations //Chemistry and Biodiversity. -  2007. - V.4. – No.6. – P.1219-1242.

19. Milov A.D., Tsvetkov Yu.D., Gorbunova E.Yu., Mustaeva L.G., Ovchinnikova T.V., Handgraaf J.-W., Raap J. Solvent effects on the secondary structure of the membrane-active zervamicin determined by PELDOR spectroscopy // Chemistry and Biodiversity. -  2007. - V.4.  - No.6. - P.1243-1255.

20. Финкина Е.И., Баландин С.В., Серебрякова М.В., Потапенко Н.А., Тагаев А.А., Овчинникова Т.В. Выделение и первичная структура новых липид-транспортирующих белков из пророщенных семян чечевицы (Lens culinaris) // Биохимия. – 2007. - Т.72. - №4. - С.533-543.

21. Берлов М.Н., Кораблёва Е.С., Андреева Ю.А., Овчинникова Т.В., Кокряков В.Н. Лактоферрин из нейтрофилов собаки: выделение, физико-химические и антимикробные свойства // Биохимия. – 2007. – Т.72. - №4. – С.551-559.

22. Ovchinnikova T.V., Balandin S.V., Aleshina G.M., Tagaev A.A., Leonova Y.F., Krasnodembsky E.G., Men’shenin A.V., Kakryakov V.N. Aurelin, a novel antimicrobial peptide from jellyfish Aurelia aurita with structural features of defensins and channel-blocking toxins // Biochem. Biophys. Res. Commun. – 2006. - V.348. - No.2. – P.514-523.

23. Raap J., Hollander J., Ovchinnikova T.V., Swischeva N.V., Skladnev D.A., Kiihne S.. Trans and surface membrane bound zervamicin IIB: 13C-MAOSS-NMR at high spinning speed // J. Biomol. NMR. – 2006. - V.35. - No.4. - P.285-293.

24. Шамова О.В., Орлов Д.С., Овчинникова Т.В., Сал Х.Г., Тверьянович И.А., Попова В.А., Орлов С.Б., Дюбин В.А., Кокряков В.Н. Антимикробные пептиды из лейкоцитов русского осетра (Acipenser guldenstadti) // Фундаментальные исследования. Биологические науки. - 2006. -  №1. – С.10-13.

25. Kropacheva T.N., Salnikov E.S., Nguyen H.-H., Reissmann S., Yakimenko Z.A., Tagaev A.A., Ovchinnikova T.V., Raap J. Membrane association and activity of membered peptide antibiotics: zervamicin IIB, ampullosporin A and antioamoebin I // BBA. -  2005. - V.1715. - No.1- P.6-18. 

26. Ovchinnikova T.V., Aleshina G.M., Balandin S.V., Krasnosdembskaya A.D., Markelov M.L., Frolova E.I., Leonova Y.F., Tagaev A.A., Krasnodembsky E.G., Kokryakov V.N. Purification and primary structure of two isoforms of arenicin, a novel antimicrobial peptide from marine polychaeta Arenicola marina // FEBS Lett. – 2004. - V. 577. - No.1-2. - P.209-214.

27. Shenkarev Z.O., Paramonov A.S., Balashova T.A., Yakimenko Z.A., Baru M.B., Mustaeva L.G., Raap J., Ovchinnikova T.V., Arseniev A.S. High stability of the hinge region in the membrane-active peptide helix of zervamicin: paramagnetic relaxation enhancement studies // Biochem. Biophys. Res. Commun. – 2004. - V.325. -  No.3- P.1099-1105.

28. Shenkarev Z.O., Balashova T.A., Yakimenko Z.A., Ovchinnikova T.V., Arseniev A.S. Peptaibol zervamicin IIB structure and dynamics refinement from trans-hydrogen bond J couplings // Biophys J. -  2004. -  V.86. - No.6. - P. 3687-3699.

29. Мальцева А.Л., Алешина Г.М., Кокряков В.Н., Овчинникова Т.В., Краснодембский Е.Г. Новые антимикробные пептиды из целомоцитов Asterias rubens // Вестник  СпбГУ. – 2004. – Сер.3. – Вып.4. – С.98-103. 

30. З.О.Шенкарев, А.С.Парамонов, Т.А.Балашова, Т.В.Овчинникова, А.С.Арсеньев. Высокая стабильность шарнирного региона в спиральном каналообразующем антибиотике зервамицине IIB в растворе метанола по данным парамагнитного усиления ЯМР релаксации //  Успехи современного естествознания. – 2004. - т.2.-  №6.-  С. 62-63.

31. Ovchinnikova T.V., Shenkarev Z.O., Yakimenko Z.A., Svishcheva N.V., Tagaev A.A., Skladnev D.A., Arseniev A.S. Biosynthetic Uniform 13C,15N-Labelling of Zervamicin IIB. Complete 13C and 15N NMR Assignment // Journal of Peptide Science. – 2003. - V.9. - No.11-12. - P.817-826.

32. Zolotarev Y.A., Dadayan A.K., Borisov Y.A., Dorokhova E.M., Kozik V.S., Vtyurin N.N., Bocharov E.V., Ziganshin R.N., Lunina N.A., Kostrov S.V., Ovchinnikova T.V., Myasoedov N.F. The effect of three-dimensional structure on the solid state isotope exchange of hydrogen in polypeptides with spillover hydrogen // Bioorg. Chem. (USA). – 2003. - V.31. - No.6. - P.453-463.

33. Milov A.D., Tsvetkov Yu.D, Gorbunova E.Yu., Mustaeva L.G., Ovchinnikova T.V., Raap J. Self-aggregation of spin-labelled zervamicin IIA in the solvents of low polarity studies by PELDOR spectroscopy // Biopolymers. – 2002. - V.64. - No.6. - P.328-336.

34. Shenkarev Z.O., Balashova T.A., Efremov R.G., Yakimenko Z.A., Ovchinnikova T.V., Raap J., Arseniev A.S. Spacial structure of zervamicin IIB bound to DPC micelles. Implication for voltage-gating // Biophys. J. – 2002. - V.82. - No.2. - P.762-771.

35. Крачковский С.А., Соболь А.Г., Овчинникова Т.В., Тагаев А.А., Якименко З.А., Азизбекян Р.Р., Кузнецова Н.И, Шамшина Т.Н., Арсеньев А.С. Выделение, биологические свойства и пространственная структура антибиотика лолоатина А // Биоорганическая химия. -  2002. - Т.28. -  № 4. - С.298-302.

36. Складнев Д.А., Рогожкина Е.А., Кондакова Е.В., Швец В.И., Свищева Н.В., Якименко З.А., Шенкарев З.О., Овчинникова Т.В., Раап Я. Получение изотопно модифицированного 13C +15N пептидного антибиотика зервамицина IIB // Биотехнология. – 2002. - Т.5. - С.33-41.

37. Bechinger B., Skladnev D.A., Ogrel A., Li X., Rogozhkina E.V., Ovchinnikova T.V., O’Neil J.D., Raap J. 15N and 31P solid-state NMR investigation on the orientation of zervamicin IIB and alamethicin in phosphatidylcholine membranes // Biochemistry (USA). – 2001. - V.40. - No.31. - P.9428-9437.

38. Korshnev D.M., Bocharov E.V., Zhuravlyova A.V., Orekhov V.Y., Ovchinnikova T.V., Billeter M., Arseniev A.S. Backbone dynamics of the channel-forming antibiotic zervamicin IIB studied by 15N NMR relaxation // FEBS Letters. – 2001. - V.495. – No.1-2. - P.52-55.

39. Краснодембская А.Д., Алёшина Г.М., Лодыгин П.А., Овчинникова Т.В., Краснодембский Е.Г., Кокряков В,Н. Новые антимикробные пептиды из целомоцитов пескожила Arenicola marina (Polychaeta, Annelida) // Вестник  СпбГУ. – 2001. – Сер.3. – Вып.4. - №27. – С.104-108. 

40. Меньшенин А.В., Алёшина Г.М., Леонова Л.E., Краснодембский Е.Г., Овчинникова Т.В.,  Кокряков В.Н. Дефенсиноподобные пептиды сцифоидной медузы Aurelia aurita // Вестник  СПбГУ. – 2001. – Сер.3. – Вып.4. - №27. – С.99-103. 

41. Balashova T.A., Shenkarev Z.O., Tagaev A.A., Ovchinnikova T.V., Raap J., Arseniev A.S. NMR structure of the channel-former zervamicin IIB in isotropic solvents // FEBS Letters. - 2000.-  V.466. - P.333-336.

42. В.В.Кухтина, К.Вайзе, А.В.Осипов, В.Г.Старков, М.И.Титов, С.Е.Есипов, Т.В.Овчинникова, В.И.Цетлин, Ю.Н.Уткин. MALDI-масс-спектрометрия для идентиикации белков в яде змей // Биоорганическая химия.- 2000. - Т. 26.-  №11. - С. 803-807.

43. Овчинникова Т.В., Тагаев А.А., Свищева Н.В., Якименко З.А., Сазыкин Ю.О. Структурно-функциональное изучение семейства антибиотиков зервамицинов из Emericellopsis salmosynnemata // Биомедицинские технологии.- 1999.- Т.11. – С.10-13.

44. Овчинникова Т.В., Тагаев А.А., Мартынова Н.Ю., Рысс И.С., Сазыкин Ю.О., Быков В.А. Выделение антибиотика-каналообразователя зервамицина из гриба Emericellopsis salmosynnemata // Биомедицинские технологии.- 1998.- Т.8. – С.78-80.

45. Зайцева Л.Г., Зайцев В.Г., Фенюк Б.А.,  Павлов П.Ф., Виленская Н.Д., Овчинникова Т.В., Плежников К.А,, Гришин Е.В., Гринкевич В.А. Исследование белкового состава ядов некоторых вимдов тропических муравьёв и их влияние на Н+-АТPазу митохондрий // Биоорганическая химия. – 1995. – Т.21. - С. 563-370.

Обзор

46. Липкин В.М., Овчинникова Т.В.. Новейшие результаты в биоорганической химии и биотехнологии // Вестник Российской академии наук, 2010, т.80, №4, с. 356-360.

Патенты

47. Баландин С.В., Овчинникова Т.В. Рекомбинантная плазмидная ДНК pET-KSI-Buf2, кодирующая гибридный белок, содержащий антимикробный пептид буфорин-2, штамм Escherichia coli BL21(DE3)/pET-KSI-Buf2 - продуцент указанного белка и способ получения антимикробного пептида буфорина-2 // Заявка на патент РФ №2007130536/13(033273) от 09.08.2007, патент RU 2 347 811, дата публикации патента 27.02.2009.

48.  Овчинникова Т.В., Арсеньев А.С., Баландин С.В., Нурмухамедова Э.К., Тагаев А.А., Темиров Ю.В., Финкина Е.И., Шенкарев З.О., Якименко З.А. Пептид LanA1, выделенный из бактерии Bacillus licheniformis VK21,  обладающий антимикробным действием // Заявка на патент РФ №2009139393 (входящий № 055834) от 27.10.2009. Решение о выдаче патента от 16.08.2010г.

49.  Овчинникова Т.В., Арсеньев А.С., Баландин С.В., Нурмухамедова Э.К., Тагаев А.А., Темиров Ю.В., Финкина Е.И., Шенкарев З.О., Якименко З.А. Пептид LanA2, выделенный из бактерии Bacillus licheniformis VK21,  обладающий антимикробным действием // Заявка на патент РФ №2009139394 (входящий № 055835) от 27.10.2009. Решение о выдаче патента от 12.08.2010 г.

50. Овчинникова Т.В., Финкина Е.И., Баландин С.В. Плазмидный вектор pE-Lc-LTP, штамм бактерии Escherichia coli для экспрессии липид-транспортирующих белков чечевицы Lens culinaris и способ получения указанных белков // Заявка на патент РФ №2009129838 (041521) от 04.08.2009. Патент RU 2415940 C1,  дата публикации патента 10.04.2011 

51. Баландин С.В., Финкина Е.И., Кокряков В.Н., Овчинникова Т.В. Плазмидный вектор pE-Trx-Aur, штамм Escherichia coli для экспрессии антимикробного пептида аурелина и способ получения указанного пептида // Заявка на патент РФ №2009143085 от 24.11.2009, решение ФИПС о выдаче патента от 13.10.2010.  Патент RU 2412999 от 27.02.2011. 

52. Aзизбекян Р.Р., Овчинникова Т.В., Арсеньев А.С., Рубин  А.Б., Кузнецова Н.И., Тагаев А.А., Шенкарев З.О., Погосян С.И., Кузин А.И., Трунов К.И., Якименко З.А. Пептидный антибиотик бактериального происхождения латероцин, подавляющий развитие микроскопических  водорослей // Заявка на патент РФ №2010113715 (019317) от 08.04.2010 г.

  53. Баландин С.В., Финкина Е.И., Овчинникова Т.В. Рекомбинантная плазмидная ДНК pE-Trx-Lc-def, штамм Escherichia coli для экспрессии антимикробного пептида дефенсина чечевицы Lens culinaris и способ получения указанного пептида // Заявка на патент № 2010154169 от 30.12.2010г.

54. Баландин С.В., Кокряков В.Н., Овчинникова Т.В. Рекомбинантная плазмидная ДНК pE-His8-TrxL-Ar2, кодирующая гибридный белок, содержащий антимикробный пептид ареницин морского кольчатого червя Arenicola marina, и штамм Escherichia coli BL21(DE3)/pE-His8-TrxL-Ar2 - продуцент гибридного белка, содержащего ареницин // Патент на изобретение № 2316590. Приоритет изобретения 16 июня 2006 г. Заявка на патент РФ №2006121112 (022922) от 16 июня 2006г. Решение о выдаче патента от 02 июля 2007г. Зарегистрировано в Государственном реесте изобретений РФ 10 февраля 2008 г.

55. Баландин С.В., Кокряков В.Н., Овчинникова Т.В.  Способ получения антимикробного пептида ареницина // Патент на изобретение № 2316595. Приоритет изобретения 16 июня 2006 г. Заявка на патент РФ №2006121111 (022921) от 16 июня 2006 г. Решение о выдаче патента 12 июля 2007 г. Зарегистрировано в Государственном реесте изобретений РФ 10 февраля 2008 г.

56. Овчинникова Т.В., Алешина Г.М., Баландин С.В., Маркелов М.Л., Краснодембская А.Д., Кокряков В.Н. Пептиды ареницины, выделенные из морского кольчатого червя Arenicola marina, обладающие антимикробным действием.  // Патент на изобретение № 2261866. Заявка  №2004103808. Приоритет изобретения  10 февраля 2004 г. Зарегистрировано в Государственном реестре изобретений РФ 10 октября 2005 г.

57. Азизбекян Р.Р., Овчинникова Т.В., Шамшина Т.Н., Тагаев А.А., Смирнова Т.А., Якименко З.А., Кузнецова Н.И., Арсеньев А.С., Кузин А.И., Соболь А.Г., Орлова М.В. Циклодекапептидный антибиотик широкого спектра антагонистического действия латероцидин. Штамм бактерий Brevibacillus laterosporus, обладающий широким спектром антагонистического действия, – продуцент антибиотика латероцидина // Патент на изобретение №2229520. Заявка  № 2002129351. Приоритет изобретения 05 ноября 2002 г. Зарегистрировано в Государственном реестре изобретений РФ 27 мая 2004 г.

Избранные тезисы докладов на международных конференциях.

58. Z.O.Shenkarev, S.V.Balandin, K.I.Trunov, A.S.Paramonov, S.V.Sukhanov, L.I.Barsukov, A.S.Arseniev, T.V.Ovchinnikova. Oligomeric structure in DPC micelles and pore formation in planar lipid bilayers give the insight into molecular mechanism of antimicrobial action of beta-hairpin peptide arenicin // Abstracts of the 36th FEBS CONGRESS Biochemistry for Tomorrow’s Medicine. - Torino, Italy. – 2011. - P.124.

59. Т.В. Овчинникова. Эндогенные антимикробные пептиды как  молекулярные факторы врожденного иммунитета и прототипы лекарственных средств нового поколения // Труды VI Московского  международного конгресса «Биотехнология: состояние и перспективы развития». -  Москва. - 2011.- Т.1. - С.122-123.

60. П.В.Пантелеев, С.В.Баландин, Т.В.Овчинникова. Получение 15N-меченного рекомбинантного антимикробного пептида аурелина // Тезисы докладов ХXIII зимней международной молодежной научной школы «Перспективные направления физико-химической биологии и биотехнологии». – Москва. - 2011. – C.156.

61. K.I. Trunov, Z.O. Shenkarev, A.S. Paramonov, P.V. Baurin, S.V. Balandin, T.V. Ovchinnikova, A.S. Arseniev. Spatial Structure and Backbone Dynamics of Asymmetric Dimer of -Hairpin Antimicrobial Peptide Arenicin-2 in Membrane Mimicking Environment // EUROMAR 2010, Abstracts of the Magnetic Resonance Conference, Florence, Italy.- 2010. – P.407.

62.  Т.В. Овчинникова Разработка лекарственных средств нового поколения на основе природных антимикробных пептидов - молекулярных факторов врожденного иммунитета // Тезисы докладов V Московского международного конгресса «Биотехнология: состояние и перспективы развития».  Москва. -  2009. – Т.1. -  С.185-187. 

63. E.N. Lyukmanova, Z.O. Shenkarev, O.V. Nekrasova, T.V. Ovchinnikova,
A.S. Arseniev. Lipid-protein nanodiscs: possible application in high-resolution NMR investigations of membrane proteins and membrane-active peptides // EUROMAR 2009: Abstracts of the Magnetic Resonance Conference. Goteborg, Sweden.-  2009. - P.50.

64. Мельникова Д.Н., Финкина Е.И., Баландин С.В., Овчинникова Т.В. Гетерологическая экспрессия липид-транспортирующего белка чечевицы в клетках E. coli // Тезисы Международной научной конференции по биоорганической химии, биотехнологии и бионанотехнологии, посвященная 75-летию со дня рождения академика Ю.А.Овчинникова. Москва. – 2009. – Т.2. – С.137-140.

65. Баландин С.В., Овчинникова Т.В. Исследование антимикробных пептидов беспозвоночных. // Тезисы докладов ХX зимней международной молодежной научной школы «Перспективные направления физико-химической биологии и биотехнологии». – Москва. - 2008. - С.19.

66. Финкина Е.И., Овчинникова Т.В. Структурно-функциональная характеристика PR-белков из проращенных семян чечевицы Lens culinaris // Тезисы докладов Международной научно-практической конференции «Биотехнология. Вода и пищевые продукты».  Москва. -  2008. -  С.227. 

67. Shenkarev Z.O., Nadezhdin K.D., Lyukmanova E.N., Ovchinnikova T.V., Skjeldal L., Arseniev A.S. The β–hairpin containing membrane-active antimicrobial peptides: from spatial structure in membrane-mimicking media to mechanisms of action // Abstracts of the 33rd FEBS Congress and 11th IUBMB Conference “Biochemistry of Cell Regulation”. Athens. – Greece. – 2008. - P. 175. 

68. Lyukmanova E.N., Shenkarev Z.O., Ovchinnikova T.V., Chupin V.V., Blommers M.J., Arseniev A.S. Reconstiuted high density lipoprotein particles: a promising medium for high-resolution NMR investigations of membrane proteins and membrane-active peptides. Abstracts of the 33rd FEBS Congress and 11th IUBMB Conference “Biochemistry of Cell Regulation”. Athens. – Greece. – 2008. - P. 171. 

69. Шенкарев З.О., Парамонов А.С., Надеждин Д.Е.,  Гагнидзе И.Э., Юрченко Ю.Ю., Люкманова Е.Н., Овчинникова Т.B., Арсеньев А.С. Структура и динамика каналообразующего пептидного антибиотика антиамебина I в различных мембрано-моделирующих средах // Тезисы докладов XV международной конференции «Новые информационные технологии в медицине, биологии, фармакологии и экологии». Симпозиум «Достижения современной биоорганической химии и перспективы их применения». Гурзуф. – Украина. -  2007.- С.306-308.

70. Shenkarev Z.O., Paramonov A.S., Nadezhdin K.D., Gagnidze I.E., Yurchenko Y.Y., Lyukmanova E.N., Bocharov E.V., Balashova T.A., Ovchinnikova T.V., Arseniev A.S.. Structure and dynamics of channel forming peptide antibiotic antiamoebin I in several membrane mimicking media // Abstracts of the International symposium «Nuclear magnetic resonance in condensed matter». The 4th meeting “NMR in life sciences”. -  Saint-Petersburg. -  2007.- P.118.

71. Финкина Е.И., Овчинникова Т.В. Выделение и первичная структура нового дефенсина из проращенных семян чечевицы Lens culinaris // Тезисы  докладов IV Московского международного конгресса "Биотехнология: состояние и перспективы развития. – Москва. -  2007. - С.308.

72. Баландин С.В., Кокряков В.Н., Овчинникова Т.В. Новые антимикробные пептиды морских беспозвоночных // Тезисы докладов международной конференции по физико-химической биологии, посвященной 70-летию со дня рождения академика Ю.А.Овчинникова. – Москва. – 2004. – С.31.

73. Шенкарев З.О., Парамонов А.С., Балашова Т.А., Овчинникова Т.В., Арсеньев А.С. Высокая стабильность шарнирного региона в спиральном каналообразующем антибиотике зервамицине IIB в растворе метанола по данным парамагнитного усиления ЯМР релаксации // Тезисы трудов XII международной конференции по новым информационным технологиям в медицине и экологии. Гурзуф. – Украина. – 2004. Успехи современного естествознания. -  2004. - Т.2. - №6. -  С. 62-63.

74. Баршунина Е.В., Якименко З.А., Складнев Д.А., Овчинникова Т.В. Получение 15N-меченого пептидного антибиотика антиамёбина I // Тезисы докладов XV зимней международной молодежной научной школы «Перспективные направления физико-химической биологии и биотехнологии». – Москва. – 2003. – С.21.

75. Z.O.Shenkarev, T.A.Balashova, T.V.Ovchinnikova, A.S.Arseniev. Structure and dynamics of peptide ion channel zervamicin IIB in membrane mimic media // Abstracts of the XI International Conference on New Information Technology in Medicine, Biology, Pharmacology, and Ecology. – Gurzuf. – Ukraine. – 2003. -P.36.

76. Ovchinnikova T.V., Yakimenko Z.A., Swischeva  N.V., Skladnev D.A., Raap J. Stable isotope labelling of the peptaibol antibiotics zervamicin IIB and antiamoebin I // Proceedings of the workshop “Peptaibols: Biosynthesis, Structural Diversity and Mode of Action”. – Jena, Germany. – 2002. – P.35.

77. Raap J., Milov A.D., Tsvetkov Yu.D., Ovchinnikova T.V., Formaggio F., Crisma M., Toniolo C. Pecularities of trichogin GA IV bound to the gram-positive bacterial cell // Proceedings of the workshop “Peptaibols: Biosynthesis, Structural Diversity and Mode of Action”. – Jena, Germany. – 2002. – P.25.

78. Ovchinnikova T.V., Baru M.B, Gorbunova E.Yu., Vazhenina I.V., Mustaeva L.G., Miroshnikov A.I., Raap J. Total Solid Phase Synthesis of the Biologically Active Peptaibol Antibiotic Zervamicin // Proceedings of the 18th International Congress of Biochemistry and Molecular Biology. - Birmingham, UK. – 2000. -  P.195.

79. Shenkarev Z.O., Balashova T.A., Yakimenko Z.A, Ovchinnikova T.V., Arseniev A.S. NMR Structure of the Channel-Former Zervamicin IIB in Isotropic Solvents and DPC Micelles: Possible Mechanism of the Voltage Activation // Abstracts of the Open Russian-Swedish Conference “NMR in Protein-Protein and Protein-DNA Recognition”. – Moscow. -  2000. - P.36.

80. Овчинникова Т.В., Тагаев А.А., Мартынова Н.Ю., Сазыкин Ю.О. Исследование зервамицинов – антибиотиков группы пептаиболов // Материалы международной конференции «Фармацевическая биоэтика». -  Москва. – 1997. – С. 66-67.

Избранные тезисы докладов на российских конференциях

81. Нурмухамедова Э.К., Баландин С.В., Овчинникова Т.В. Определение нуклеотидной последовательности и гетерологичная экспрессия генов предшественника лантибиотика LanA1 и модифицирующего его фермента LanM1 из штамма Bacillus licheniformis VK21 // Тезисы докладов ХXII зимней молодежной научной школы «Перспективные направления физико-химической биологии и биотехнологии». – Москва. - 2010. - С.110.

82. Е.А.Корнева, Г.М. Алёшина, С.В.Перекрест,  В.Н. Кокряков, С.В. Баландин, Е.И. Финкина, А.А. Тагаев, Т.В.Овчинникова. Конструирование лекарственных средств нового поколения на основе пептидных антибиотиков животного происхождения.  Тезисы итоговой конференции по результатам выполнения мероприятий за 2009 год в рамках приоритетного направления «Живые системы» ФЦП «Исследования и разработки по приоритетным направлениям развития научно-технологического комплекса России на 2007-2012 годы». Москва. – 2009. - C.42-43.

83. Мельникова Д.Н., Финкина Е.И., Баландин С.В., Овчинникова Т.В. Получение рекомбинантного липид-транспортирующего белка чечевицы обыкновенной Lens culinaris // Тезисы докладов ХXI зимней молодежной научной школы «Перспективные направления физико-химической биологии и биотехнологии». – Москва. - 2009. - С.66.

84. Овчинникова Т.В., Кокряков В.Н. Конструирование лекарственных средств нового поколения на основе природных пептидных антибиотиков - молекулярных факторов врожденного иммунитета // Тезисы докладов симпозиума «Результаты фундаментальных и прикладных исследований для создания новых лекарственных средств».- Москва. – 2008. – C. 147-148.

85. Меньшенин А.В., Алёшина Г.М., Кокряков В.Н., Корнева Е.А.,  Баландин С.В., Финкина Е.И., Якименко ЗА., Тагаев А.А., Овчинникова Т.В. Конструирование лекарственных средств нового поколения на основе пептидных антибиотиков животного происхождения // Тезисы итоговой конференции по результатам выполнения мероприятий за 2008 год в рамках приоритетного направления «Живые системы» ФЦП «Исследования и разработки по приоритетным направлениям развития научно-технологического комплекса России на 2007-2012 годы». Москва. – 2008. - С.126-127.

86. Овчинникова Т.В., Баландин С.В., Тагаев А.А., Финкина Е.И., Шенкарев З.О., Якименко З.А. Создание лекарственных средств нового поколения на основе природных антимикробных пептидов // Тезисы докладов на конференции по научным направлениям Программы фундаментальных исследований РАН «Фундаментальные науки – медицине».  Москва. – 2008. - С.158-159.

87. Надеждин К.Д., Шенкарёв З.О., Баландин С.В., Овчинникова Т.В., Арсеньев А.С. Исследование пространственной структуры и механизмов специфической олигомеризации β–структурного антимикробного пептида ареницина-2 // Труды 50-й научной конференции МФТИ. Часть IV «Молекулярная и биологическая физика». Москва-Долгопрудный. -  2007. - C.240-241.

88. Финкина Е.И., Овчинникова Т.В. Новый дефенсин из семян чечевицы Lens culinary // Тезисы докладов III Российского симпозиума «Белки и пептиды». – Пущино. - 2007. - С.20.

89. Баландин С.В., Надеждин К.Д., Шенкарев З.О., Кокряков В.Н., Арсеньев А.С., Овчинникова Т.В. Гетерологичная экспрессия и исследование пространственной структуры новых антимикробных пептидов ареницинов // Тезисы докладов XIX зимней молодежной научной школы "Перспективные направления физико-химической биологии и биотехнологии". – Москва. - 2007. - С.23.

90. Баландин С.В., Овчинникова Т.В. Получение рекомбинантных антимикробных пептидов морских беспозвоночных // Тезисы докладов ХVIII зимней молодежной научной школы «Перспективные направления физико-химической биологии и биотехнологии». – Москва. - 2006. - С.29.

91. Баландин С.В., Кокряков В.Н., Овчинникова Т.В. Новый антимикробный пептид аурелин из сцифоидной медузы Aurelia aurita: определение полной последовательности кДНК, кодирующей препроаурелин, и гетерологичная экспрессия в E.coli // Тезисы докладов VIII чтений, посвященных памяти академика Ю.А. Овчинникова. - Москва-Пущино. - 2006. - С.59. 

92. Финкина  Е.И., Баландин С.В., Овчинникова Т.В. Новый дефенсиноподобный белок из семян чечевицы обыкновенной Lens culinaris // Тезисы докладов ХVIII зимней молодежной научной школы «Перспективные направления физико-химической биологии и биотехнологии». – Москва. – 2006. - С.53.

93. Баландин С.В., Кокряков В.Н., Овчинникова Т.В. Структурные исследования новых антимикробных пептидов животного происхождения // Тезисы докладов XVII зимней молодежной научной школы "Перспективные направления физико-химической биологии и биотехнологии". – Москва.  - 2005. – С.31-32.

94. Кокряков В.Н., Алешина Г.М., Шамова О.В., Овчинникова Т.В. Антибиотические пептиды как эффекторные и регуляторные факторы врожденного иммунитета // Тезисы докладов объединенного иммунологического форума. – Екатеринбург. – 2004. - Russian Journal of Immunology. - 2004. - V.9 – Suppl.1. - P.73. 

95. Алешина Г.М., Мальцева А.Л., Краснодембский Е.Г., Овчинникова Т.В. Антибиотические факторы морской звезды Asterias rubens // Тезисы докладов объединенного иммунологического форума. – Екатеринбург. – 2004. - Russian Journal of Immunology. - 2004. - V.9 – Suppl.1. - P.71.

96. Финкина Е.И., Овчинникова Т.В. Выделение белково-пептидных антибиотиков из семян чечевицы Ervum lens // Тезисы докладов  XVI зимней молодежной научной школы «Перспективные направления физико-химической биологии и биотехнологии». -  Москва. – 2004. - С.43.

97. Дьяченко И.А., Коршунов В.А., Мурашев А.Н., Свищева Н.В., Якименко З.А., Овчинникова Т.В. Исследование нейротропной активности антибиотика-пептаибола зервамицина // Тезисы трудов научной конференции ФИБХ РАН. – Пущино. – 2004. – С.7.

98. Якименко З.А., Свищева Н.В., Складнев Д.А., Овчинникова Т.В. Выделение 13C,15N-меченого антибиотика зервамицина IIB, полученного биотехнологическим методом // Тезисы докладов III съезда биохимического общества. – Санкт-Петербург. – 2002. – С.562-563.

99. Овчинникова Т.В., Алёшина Г.М., Потапенко Н.А., Леонова Ю.Ф., Меньшенин А.В., Кокряков В.Н. Новый пептидный антибиотик из  сцифоидной медузы Aurelia aurita // Тезисы докладов III съезда биохимического общества. – Санкт-Петербург. – 2002. – С.556. 

100. Якименко З.А., Свищева Н.В., Тагаев А.А., Овчинникова Т.В. Структурно-функциональное исследование антибиотиков-пептаиболов зервамицинов из гриба Emericellopsis salmosynnemata” // Тезисы трудов школы-конференции «Горизонты физико-химической биологии». -  Пущино. - 2000. - С.111-112.

101. Горбунова Е.Ю., Бару М.Б., Важенина И.В., Мустаева Л.Г., Раап Я., Мирошников А.И., Овчинникова Т.В. Синтез биологически активных [D-Iva4] и [L-Iva4] зервамицинов IIB // Тезисы трудов отчетной конференции ФИБХ РАН. – Пущино. – 1999. – С.12-13.

 






© 2011 www.dissers.ru - «Бесплатная электронная библиотека»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.