WWW.DISSERS.RU

БЕСПЛАТНАЯ ЭЛЕКТРОННАЯ БИБЛИОТЕКА

   Добро пожаловать!


 

                                                               

На правах рукописи

                                                                       









Новикова Ольга Данииловна

Порообразующие белки бактерий рода Yersinia.

структура и свойства


02.00.10 биоорганическая химия




Автореферат




диссертации на соискание ученой степени

доктора химических наук


















Владивосток, 2007 г.

Работа выполнена в Тихоокеанском институте биоорганической химии

Дальневосточного отделения  РАН

Официальные оппоненты:                 академик РАМН,

доктор медицинских наук,

профессор Беседнова Н.Н.

                                                        

                 доктор биологических наук,

профессор Деев С.М.

                                                                                                                                                               доктор химических наук,

                                                       профессор Каминский В.А.

Ведущая организация:                                        Институт биохимии

им. А.Н. Баха РАН 

Защита состоится  « 1 » ноября 2007 г. в 10 часов  на заседании  Диссертационного совета Д 005.005.01 в Тихоокеанском институте биоорганической химии ДВО РАН  по адресу:

690022, г. Владивосток, проспект 100 лет Владивостоку, 159, ТИБОХ ДВО РАН.

Факс: (4232)314-050, e-mail: science@piboc.dvo.ru

       С диссертацией можно ознакомиться в филиале Центральной научной библиотеки ДВО РАН (г. Владивосток, проспект 100 лет Владивостоку, 159, ТИБОХ ДВО РАН).

Автореферат разослан          «  »  сентября 2007 г.

Ученый секретарь

Диссертационного совета,

кхн, снс                         Г.И. Прокопенко

ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ

Актуальность исследования
Взаимоотношения поверхностных структур бактериальной клетки с организмом человека являются определяющими в развитии инфекционного процесса. В связи с этим установление биологической функции отдельных компонентов наружной мембраны (НМ) бактерий имеет не только теоретический интерес, но и связано с решением целого ряда прикладных вопросов, таких, как создание эффективных вакцинных препаратов и усовершенствование диагностики заболеваний.

Наряду с цитоплазматической мембраной грамотрицательные бактерии имеют НМ, характерный структурный элемент, отличающий их от клеток эукариот. Главное предназначение дополнительного мембранного слоя состоит в барьерной функции, обеспечивающей селективную проницаемость оболочки микроорганизмов. Мембранные белки, которые составляют около 30% от общего содержания протеинов клетки, достаточно сложны в структурном отношении и разнообразны по функциональным свойствам. Среди белков НМ грамотрицательных бактерий доминируют интегральные β-структурированные белки, так называемые неспецифические порины, которые осуществляют пассивную диффузию гидрофильных молекул с молекулярной массой < 600 Да. Они образуют трансмембранные водонаполненные каналы (или поры), через которые клетка обменивается с внешней средой низкомолекулярными веществами.

К середине 80-х гг. прошлого века исследователи уже располагали информацией об основных (фундаментальных) свойствах каналов, образуемых  поринами E.coli (OmpF и OmpC белками), а также об асимметричном строении НМ за счет расположения ЛПС на ее  внешней стороне. За последующие 20 лет накопление знаний в исследовании структуры и функции поринов происходило очень быстро, порой взрывообразно. Так, за этот период появилось более 650 статей, имеющих в заглавии термин «порин». По своим физико-химическим свойствам это слабокислые белки с необычайно большим для интегральных мембранных белков количеством полярных аминокислот. Основным структурным элементом поринов является эллипсообразный в сечении складчатый цилиндр (баррель), состоящий из антипараллельных β-тяжей (или стрэндов), соединенных так называемыми петлями, участками полипептидной цепи белка с неупорядоченной и/или α-спиральной структурой. В нативной мембране порины существуют в виде тримеров, которые рассматривают как основную функциональную единицу в структуре НМ. В изолированном состоянии порины представляют собой олигомерные белки, в стабилизации пространственной структуры которых, помимо гидрофобных взаимодействий, существенную роль играют водородные и ионные связи. Этим объясняется необычайная устойчивость поринов по отношению к протеазам, повышенной температуре и другим денатурирующим факторам.

Показано, что структурная организация поринов в изолированном состоянии и в мембране во многом определяется другим основным компонентом НМ - ЛПС, специфическим амфифильным биополимером, чаще всего определяющим антигенную специфичность бактерий. Взаимодействие с ЛПС влияет на тримеризацию поринов и встраивание их в мембрану. До сих пор не существует единого мнения по поводу значения ЛПС для функциональной активности поринов.

Согласно современным представлениям в процессе осуществления транспортной функции порины являются не просто статичным фильтром бактериальной мембраны, а проявляют себя как динамичная структура. Известно, что тип популяции неспецифических поринов (OmpF или OmpC) может изменяться с изменением условий окружающей среды, что позволяет клетке регулировать проницаемость НМ. Это происходит благодаря механизму «переключения» биосинтеза поринов, кодируемых различными генами, например, при переходе клетки из "непаразитического" состояния (в природных условиях) в "паразитическое" (в макроорганизме). В то же время один и тот же тип поринов может иметь два или более субсостояний, различающихся размером пор.  Это зависит от липидного состава мембраны и внешних факторов (рН среды, осмотического давления, мембранного потенциала). Такой характер изменения проводимости каналов может реализоваться только при условии конформационной пластичности поринов, т.е. повышенной изменчивости молекулярной организации на уровне третичной структуры белка.

При извлечении из мембраны -баррельные белки частично денатурируют, а в присутствии липидного бислоя in vitro могут спонтанно восстанавливать нативную пространственную структуру. В нативной мембране их сворачиванию и сборке, как правило, способствуют шапероны, специальные молекулы липидной и белковой природы. Согласно последним данным по исследованию термодинамической стабильности и механизмов встраивания поринов в модельные и биологические мембраны стабильность их не столь велика, как считалось ранее (меньше 10 ккал/моль), и она модулируется эластичными свойствами липидного матрикса.

Поскольку кристаллическая структура доступна для ограниченного числа белков, в том числе поринов, информация о первичной структуре как можно большего числа этих белков весьма желательна и полезна для моделирования их  пространственной организации. Например, до сих пор  не существует простого алгоритма, с помощью которого можно было бы удовлетворительно определить местоположение -стрэндов. Одним из вариантов решения этой задачи является поиск наименее вариабельных участков аминокислотной последовательности при сравнении последовательностей близкородственных белков. Несмотря на то, что способность поринов к образованию множества стабильных конформационных состояний подтверждена экспериментально, установление элементов пространственной структуры этих белков, ответственных за изменения их функциональных свойств, до сих пор остается предметом повышенного внимания исследователей. Детальный кинетический анализ -баррельных мембранных белков показал, что их сборка осуществляется в несколько этапов с образованием целого ряда интермедиатов, которые могут быть зафиксированы in vitro, при  этом образование барреля синхронизировано со встраиванием в мембрану. Тем не менее, многие вопросы, связанные с деталями фолдинга порообразующих белков in vivo, до сих пор остаются открытыми.  Неясно, например, что является определяющим для реконструкции порина в липидный бислой: наличие определенной конформации, обеспечивающей термодинамически оправданный процесс встраивания и/или присутствие в мембране специфических липидов, играющих в данном процессе роль векторов.

Особенности структуры и поверхностная локализация в клетке обуславливают наличие у бактериальных поринов различных биологических свойств, отличных от транспортной функции. Петли поринов являются потенциальными участками для контакта/связывания других клеток с поверхностью бактерии. Как  молекулы-мишени для системы иммунитета макроорганизма порины активируют факторы немедленной защиты хозяина и включаются в формирование специфического иммунного ответа, направленного на освобождение от патогена. С другой стороны, они выступают как эффекторы патогенеза, подавляя отдельные стадии иммунной защиты хозяина, и обеспечивая выживание патогена в макроорганизме. Эти факты позволяют рассматривать порообразующие белки НМ бактерий как весьма перспективные соединения (инструменты)  для решения задач инфекционной иммунологии. Прежде всего, это связано с выявлением среди поверхностных белков бактерий вероятных кандидатов для конструирования протективных и диагностических препаратов, а также с определением «ключевых» для патогенеза молекул в целях реализации новых стратегий в борьбе с патогенами и создания лекарственных средств  для терапии инфекционных болезней.

Выбор иерсиний в качестве источника исследуемых  поринов был обусловлен тем, что иерсиниозы имеют большой удельный вес в инфекционной патологии человека. Учитывая растущую роль овощных культур в заболеваемости иерсиниозами, несомненна также  эпизоотологическая актуальность вопроса о патогенных бактериях, общих для человека и растений.  Кроме того, возбудители псевдотуберкулеза и кишечного иерсиниоза имеют широкое распространение и особую эпидемиологическую значимость на территории Приморского края. Многообразие клинических форм, часто маскирующих эти заболевания под другие кишечные инфекции, осложняет  их диагностику. Более того, в силу ряда причин фактическая заболеваемость иерсиниозами, в частности псевдотуберкулезом, превышает официально зарегистрированную. Прежде всего, это объясняется  недостаточной эффективностью лабораторной и клинической диагностики, а также  модификацией эпидемиологических особенностей возбудителя.  Во-первых,  в последние годы заболевание чаще всего протекает в виде спорадических случаев, а не эпидемических вспышек, характерных для Дальневосточного региона последней четверти прошлого века. Во-вторых, значительные затруднения при установлении этиологии кишечных расстройств вызывает тот факт, что в современных условиях возбудитель псевдотуберкулеза  «высевается» не более, чем в 5% случаев, т.е. не может быть определен  с помощью бактериологического анализа. Следует особо подчеркнуть, что согласно анализу возрастной и социальной структуры больных иерсиниозами основную часть заболевших составляют дети от 3-х до 14-ти лет (85 и 97% соответственно). В этих условиях увеличивается значимость лабораторной диагностики иерсиниозов, что, в свою очередь, определяет устойчивое внимание исследователей к совершенствованию и разработке новых методов диагностики этих заболеваний.

Цели и задачи исследования

Целью данной работы являлось комплексное исследование структуры и свойств неспецифических поринов иерсиний для установления взаимосвязи между пространственной организацией и функциональной активностью порообразующих белков НМ грамотрицательных бактерий, а также выяснения их роли в патогенезе инфекций, вызываемых микроорганизмами рода Yersinia.

Для достижения поставленной цели необходимо было решить следующие задачи:

  • выделить и охарактеризовать физико-химические свойства поринов из 5-ти видов иерсиний: 2-х видов, патогенных для человека (Y. pseudotuberculosis и Y. enterocolitica), и 3-х непатогенных видов (Y. intermedia, Y. frederiksenii и Y. kristensenii);
  • установить первичную и пространственную структуру полученных белков;
  • провести сравнительное изучение функциональной активности поринов патогенных и непатогенных иерсиний;
  • изучить конформационные переходы поринов в растворе (на примере порина из псевдотуберкулезного микроба) под действием различных денатурирующих факторов и охарактеризовать пространственную структуру полученных денатурированных форм порина;
  • определить роль ЛПС в стабилизации структуры и проявлении функциональной активности порина;
  • изучить влияние условий культивирования бактерий псевдотуберкулеза (и связанного с ним изменения состава липидного матрикса НМ микроорганизма) на пространственную организацию и функциональные свойства поринов;
  • охарактеризовать антигенную структуру и изучить иммуногенные свойства порина из псевдотуберкулезного микроба;
  • выяснить роль поринов в процессе развития инфекционного процесса (патогенеза) иерсиниозов;
  • получить рекомбинантный порин из НМ Y. pseudotuberculosis, подобрать условия рефолдинга функционально активной формы этого белка, охарактеризовать пространственную и антигенную структуру интермедиатов рефолдинга порина;
  • показать возможность использования неспецифических поринов НМ иерсиний в качестве диагностических и протективных антигенов.

Научная новизна исследования

Впервые проведено систематическое исследование неспецифических OmpF-подобных поринов НМ грамотрицательных бактерий рода Yersinia. Установлена их аминокислотная последовательность, определена пространственная структура и охарактеризованы функциональные свойства этих белков, являющихся, наряду с ЛПС, основными компонентами НМ этих микроорганизмов.

Определена роль ЛПС в поддержании функционально активной конформации поринов. Изучен процесс образования ЛПС-поринового комплекса in vitro и показано, что характер взаимодействия белка и  эндогенного ЛПС зависит от структуры последнего.

Показано, что условия перевода поринов из мембраносвязанного состояния в раствор влияют на стабильность и пространственную  структуру изолированного порина. Экспериментально продемонстрирована конформационная пластичность  изолированных поринов в растворе на  уровне третичной структуры белка.

Выполнено систематическое исследование конформационных переходов OmpF-подобного порина из псевдотуберкулезного микроба (иерсинина) под действием денатурирующих факторов. На его примере показано, что для поринов характерна множественность денатурированных состояний.

Впервые на примере иерсинина показано, что при изменении значений рН среды порообразующие белки НМ грамотрицательных бактерий, подобно мультидоменным ферментам, имеют два конформационных перехода: функциональный и денатурационный. рН-Индуцированные интермедиаты порина охарактеризованы в терминах основных переходных состояний белков, образующихся в процессе денатурации.

Установлено, что изменение состава липидного матрикса НМ иерсиний коррелирует с изменениями в пространственной организации и функциональной активности неспецифических OmpF-подобных поринов.

Впервые получен функционально активный тример рекомбинантного порина из псевдотуберкулезного микроба.


Практическая значимость работы

Впервые показано, что OmpF-подобные порины НМ иерсиний являются видо- и родоспецифическими белками этих бактерий и  могут быть использованы в качестве диагностических и протективных антигенов.

Показано, что иммунизация порином эффективно защищает лабораторных животных  от  экспериментальной псевдотуберкулезной инфекции. Обнаружено, что как  протективные антигены тримерная и мономерная  молекулярные формы белка обладают различной эффективностью.

Впервые  на основе порина из НМ Y. pseudotuberculosis разработан иммуноферментный анализ (ИФА), позволяющий достоверно и эффективно идентифицировать  псевдотуберкулез, в том числе на ранних стадиях развития инфекционного процесса. Данная тест-система может быть использована в клинической практике для дифференциальной диагностики псевдотуберкулеза и кишечного иерсиниоза, а также выявления вторично-очаговых форм этих заболеваний. Показано, что рекомбинантный порин высокоэффективен в качестве диагностического антигена.

Результаты и положения работы, выносимые на защиту:

1. Бактерии рода Yersinia  содержат в НМ порообразующие белки, обладающие высокой степенью гомологии первичной структуры. Они являются родоспецифическими белками иерсиний.

2. Порины входят в состав ЛПБК – полного О-соматического антигена НМ грамотрицательных бактерий.

3. Способ (процедура) выделения белка влияют на стабильность и пространственную организацию функционально активной тримерной формы порина.

4. Вторичная структура изолированных поринов отличается повышенной устойчивостью к денатурирующим факторам/агентам. Для более высоких уровней пространственной структуры поринов (четвертичной и третичной) характерна конформационная пластичность, обуславливающая образование различных конформационных интермедиатов, структуру которых определяют условия их получения.

5. При изменении значения рН среды порообразующий белок НМ псевдотуберкулезного микроба, иерсинин, претерпевает два конформационных перехода: функциональный и денатурационный, что, вероятно, служит дополнительным механизмом адаптации иерсиний к изменению условий внешней среды.

6. Каналы, образуемые поринами патогенных и непатогенных иерсиний в искусственном бислое, отличаются по размеру и характеру распределения уровней проводимости.

7. Порины патогенных видов иерсиний являются диагностическими и протективными антигенами. Тримерная и мономерная молекулярные формы поринов  существенно различаются по иммуногенным свойствам и, соответственно, по эффективности защиты лабораторных животных от экспериментальной иерсиниозной инфекции.

8. ИФА тест-система на основе порина из НМ Y. pseudotuberculosis позволяет выявлять заболевание, вызываемое всеми сероварами псевдотуберкулезного микроба.

9. Данная тест-система может использоваться как для дифференциальной диагностики острых форм иерсиниозов, так и для выявления некоторых иммунопатологий (вторично-очаговых форм), вызываемых иерсиниями.

10. OmpF-подобный порин из НМ Y. pseudotuberculosis является фактором вирулентности псевдотуберкулезного микроба, способствуя адгезии и инвазии бактерий в макроорганизм.

       Апробация результатов работы

       Основные результаты диссертационной работы были представлены  автором в виде устных докладов и постерных сообщений на следующих Всесоюзных, Всероссийских и Международных конференциях: Советско-Индийском симпозиуме по химии природных соединений (Тбилиси, Грузия, 1983); 1-ом и 2-ом Биохимических съездах (соответственно Киев, Украина, 1986 и Москва, Россия, 1997); Симпозиумах по химии белков и пептидов  (Таллинн, Эстония, 1987; Москва, 2003, Россия; Москва, Россия, 2007); International Symposiums on Yersinia  (Tokyo, Japan, 1995;  Turku, Finnland, 2003); II и III Cъездах биофизиков России  (соответственно Москва, Россия,1999 и Воронеж, Россия, 2004); ХIХ Pacific Science Congress (Sydney, Australia, 1999); Международной научно-практической конференции “Проблемы иерсиниозов и других актуальных инфекций” (Санкт-Петербург, Россия, 2000);  7-th International Congress on Endotoxin (Washington, USA, 2002); 3-rd  German-Polish-Russian Meeting on Bacterial Carbohydrates  (Wroclaw,  Poland,  2004); International Congress “Progress in Fundamental and Applied Sciences for Human Health” (Sudak, Ukraine, 2004); I Cъезде физиологов СНГ (Сочи, Россия, 2005); Российской научно-практической конференции «Современные технологии в иммунологии: иммунодиагностика и иммунотерапия» (Курск, Россия, 2006); V Cимпозиуме с международным участием «Физиология иммунной системы. Перспективные подходы к диагностике и терапии иммунопатологий и аллергических заболеваний» (Москва, Россия, 2006) .        

Публикации

По теме диссертационной работы опубликовано 38 статей в отечественных и международных журналах и более 60 тезисов докладов в сборниках трудов Всесоюзных, Всероссийских и Международных конференций. Способ получения порина из псевдотуберкулезного микроба и способ диагностики псевдотуберкулеза защищены патентами РФ.

Структура и объем диссертации

Диссертационная работа состоит из введения, обзора литературы, 9-ти глав с изложением результатов работы и их обсуждения, описания материалов и методов исследования, заключения, выводов и списка цитируемой литературы, включающего 357 источников  Диссертация изложена на 267 страницах машинописного текста, содержит 52 рисунка и 25 таблиц.

Благодарности за научное сотрудничество и помощь в работе

Автор выражает  искреннюю и глубокую признательность научным консультантам: дхн, профессору Т.Ф. Соловьевой и академику РАН Ю.С. Оводову  за постоянное внимание к работе, ценные замечания и полезные советы на всех этапах исследования.  Автор чрезвычайно благодарен  сотрудникам лаборатории молекулярных основ антибактериального иммунитета и других лабораторий ТИБОХ ДВО РАН, принимавшим непосредственное участие в работе или участвовавшим в обсуждении полученных результатов: кхн В.А.Хоменко, кхн Г.М.Фроловой, кф-мн Г.Н. Лихацкой, нс О.П. Востриковой, кбн О.Ю. Портнягиной, нс Н.Ю. Ким, кхн Т.И. Вакориной, кмн М.П. Исаевой (особая благодарность), мнс К.В. Гузеву, дхн П.А. Лукьянову, кф-мн В.П. Глазунову, кхн И.Н. Красиковой, кхн Г.А. Набережных, кхн В.И. Горбачу, кбн В.А. Рассказову.

Автор также искренне признателен и благодарен за плодотворное сотрудничество в рамках проведенных исследований: кф-мн В.И. Емельяненко и нс С.М. Кузнецовой, сотрудникам Института теоретической и экспериментальной биофизики РАН (г. Пущино, Московской области); кхн Н.П. Бажулиной, снс Института молекулярной биологии РАН (г. Москва), дмн, проф. Н.Ф. Тимченко, сотруднику НИИЭМ РАМН; (г. Владивосток); дбн, проф. Скок М.Н, сотруднику Института биохимии им. А.В. Палладина (г. Киев, Украина); дмн, проф. А.В. Гордеец, кмн. В.Ю. Малашенковой, д.м.н. С.Н.Бениовой, сотрудникам кафедры детских инфекционных болезней ВГМУ (г. Владивосток); И. В. Дармову, В.И Дробкову, И.В. Маракулину, И.П.Погорельскому и М.В. Супотницкому, сотрудникам Института микробиологии МО РФ (г. Киров). Особую благодарность автор выражает  дф-мн, проф. С.Ю. Веньяминову (США) за чрезвычайно полезные замечания и советы при обсуждении результатов работы, а также Главному инфекционному врачу Приморского края, зав. кафедрой инфекционных болезней ВГМУ дмн, В.А. Иванис за искреннюю заинтересованность и неоценимую помощь при апробации и внедрении в клиническую практику ИФА тест-системы для диагностики псевдотуберкулеза.

Сокращения, используемые в диссертационной работе: АК - аминокислота/ аминокислотный; БЛМ - бислойные липидные мембраны; ДМХ - диметиламинохалкон; ДОХ -дезоксихолат натрия; ДСК - дифференциальная сканирующая микрокалориметрия, КД - круговой дихроизм, ЛПБК - липополисахарид-белковый комплекс, ЛПС - липополисахарид, ЛФЭ -лизофосфатидилэтаноламин; М – молекулярная масса; НМ - наружная мембрана; ОГ- β-D-октилглюкозид; ПГ - пептидогликан; ПГБК - пептидогликан-белковый комплекс; ПЦР - полимеразная цепная реакция; РНГА – реакция непрямой гемагглютинации; ТВ - тельца включения; ТЛБ - термолабильная (-ные) и ТСБ – термостабильная (-ные) молекулярные формы порина; ТХУ – трихлоруксусная кислота; SDS - додецилсульфат натрия; ДФГ – дифосфатидилглицерин; ФГ – фосфатидилглицерин; ФЛ – фосфолипиды; НЛ - нейтральные липиды; ФП - фагоцитарный показатель; ФЧ - фагоцитарное число, ФНА - 1-N-фенилнафтиламин; ЭДТА - этилендиаминтетрауксусная кислота; SDS,ПААГ-электрофорез - электрофорез в полиакриламидном геле в присутствии додецилсульфата натрия; Zw 3-14 - цвиттерионный  детергент Zwittergent 3-14.

СОДЕРЖАНИЕ РАБОТЫ

В обзоре литературы, состоящем из 9 разделов, обобщены литературные сведения о структуре и биологических свойствах неспецифических OmpF-подобных поринах НМ грамотрицательных бактерий. Охарактеризованы типы интегральных мембранных белков и особенности их пространственной структуры; наиболее полно рассмотрены детали молекулярной организации β-структурированных порообразующих белков НМ грамотрицательных бактерий. Проанализированы имеющиеся в литературе данные о функциональных свойствах неспецифических поринов и механизмах модуляции размера образуемых ими каналов в ответ на изменение условий окружающей среды. Охарактеризована антигенная структура и иммуногенные свойства этих белков.

РЕЗУЛЬТАТЫ И ИХ ОБСУЖДЕНИЕ

Накопленные к настоящему времени экспериментальные данные о функциональной активности поринов не всегда могут быть исчерпывающе объяснены с точки зрения современных представлений о пространственной организации этих белков, так как рентгеноструктурный анализ высокого разрешения выполнен лишь для ограниченного числа поринов. Тем не менее, именно благодаря сведениям о кристаллической структуре  поринов к настоящему времени процесс диффузии низкомолекулярных веществ через пориновые каналы описан в деталях на молекулярном уровне. По этой же причине в современных исследованиях структуры и функции поринов значительно возросли доля и значение теоретических подходов, использующих методы молекулярной динамики. Построение пространственных моделей поринов с помощью расчетных методов и оценка энергетических характеристик их различных конформационных форм позволяют объяснить многие структурно-функциональные особенности этих белков, однако в большинстве случаев теоретические методы анализа недостаточно эффективны и требуют корреляции с экспериментальными данными. В связи с вышесказанным исследования, сочетающие в себе различные экспериментальные подходы, не утрачивают своего значения и на современном уровне развития знаний о порообразующих белках НМ грамотрицательных бактерий, этих «интригующих белках» по выражению Хироши Никаидо, одного из самых маститых исследователей поверхностных антигенов грамотрицательных бактерий.

1. Выделение и характеристика OmpF-подобных поринов иерсиний

       Перевод мембранных белков из мембраносвязанного состояния в раствор сопряжен с определенными трудностями, связанными, прежде всего, с подбором подходящего солюбилизирующего агента. В зависимости от природы используемого детергента и условий экстракции, исследователи получают различные молекулярные формы и конформеры изолированных поринов, отличающихся друг от друга вторичной и третичной структурой.

Порин НМ Y. pseudotuberculosis (иерсинин). По данным SDS,ПААГ-электрофореза в состав клеточной стенки псевдотуберкулезного микроба входит до 10 полипептидов, четыре из них, с М 60, 40, 35 и 14,5 кДа, преобладают. Около 40% от общего содержания белка приходится на полипептид с М 40 кДа, основной белок НМ Y. pseudotuberculosis. Как показали предварительные исследования, этот полипептид в качестве основного белкового компонента присутствовал в ЛПБК, извлекаемом ТХУ (антигене Буавена), а при солюбилизации НМ псевдотуберкулезного микроба с помощью SDS доминировал во фракции белков, ассоциированных с ПГ.

Известно, что в нативной мембране бактерий порины связаны с ПГ прочной (но не ковалентной) связью. С целью получения изолированных белков для разрушения этого комплекса обычно используют два принципиально разных подхода: (1) обработку комплекса раствором SDS при повышенной температуре (метод Розенбуша в модификации Райтмайера и Брага) и (2) расщепление ПГ слоя лизоцимом (метод Нюрминен). В первом случае в зависимости от температурного режима, используемого для диссоциации ПГ-белкового комплекса, порины могут быть получены в виде двух ТЛБ молекулярных форм, тримера и/или мономера (не выше 40оС) или в виде ТСБ формы, термоденатурированного мономера (при 70оС и выше). Это связано с тем, что порины являются термозависимыми белками и в растворах SDS сохраняют тримерную структуру до определенной, так называемой критической температуры. Нагревание тримеров в растворах SDS при температуре выше критической приводит к образованию денатурированных мономеров, отличающихся от тримеров повышенной чувствительностью к протеолизу.

Для получения препаративного количества иерсинина мы использовали оба вышеупомянутых метода. Фракцию клеточных оболочек псевдотуберкулезного микроба, полученную после механической дезинтеграции клеток, экстрагировали тритоном Х-100, мягким детергентом, избирательно растворяющим белки цитоплазматической мембраны. Осадок обрабатывали раствором SDS для получения комплекса ПГ с ассоциированными с ним белками НМ, тример иерсинина был выделен экстракцией комплекса 1-2% раствором SDS в присутствии 0,5 М NaCl при 37оС (Пор-SDS). Второй способ извлечения белка основан на устойчивости тримеров порина к трипсину. Он включает в себя инкубацию обработанных ЭДТА и лизоцимом клеточных оболочек с трипсином в тритоне Х-100 для очистки от сопутствующих белков и осаждение олигомеров порина при 42оС из полученного раствора при рН 6,0 в присутствии 0,5 М NaCl (Пор-Lys).

Следует отметить, что экстракция поринов раствором SDS при повышенной температуре приводит к получению тримера и мономера порина (рис.1а, дорожка 1; показано на примере иерсинина). Напротив, использование метода Нюрминен, как правило, позволяет получить порин только в олигомерной форме (рис.1б, дорожки 5-8; показано на примере поринов из Y. enterocolitica и непатогенных иерсиний). Очистку от сопутствующих белков и разделение тримеров и мономеров иерсинина проводили гель-хроматографией на сефакриле S-300. Два цикла гель-хроматографии позволили получить обе молекулярные формы в индивидуальном состоянии (по данным SDS,ПААГ-электрофореза). Кажущаяся М тримера иерсинина составляет 110-120 кДа, ТЛБ мономера – 33,5 кДа. Тримеры порина выявлялись на электрофореграмме в виде мультиплетных зон, что характерно для поринов энтеробактерий и объясняется присутствием в образцах белка связанного ЛПС. Согласно аналитическим данным образец иерсинина содержал 5-8% моносахаридов. При предварительном кипячении образцов белка тример и мономер иерсинина превращались в мономер с М 40 кДа (рис. 1а, дорожка 2).

Дальнейшую препаративную очистку термоденатурированного мономера иерсинина проводили с помощью метода изоэлектрофокусирования. В результате был получен образец порина, гомогенный по данным N-концевого анализа. N-Концевой аминокислотой иерсинина является аланин. Путем твердофазной автоматической деградации по Эдману была определена N-концевая аминокислотная последовательность иерсинина: Ala-Glu-Ileu-Asn-Lys-Asp-Gly-Asn-Lys-Leu-Asp-Leu-Tyr-. Установленный участок аминокислотной последовательности основного белка НМ Y. pseudotuberculosis почти полностью совпадает с N-концевой последовательностью Omp F порина из НМ E.coli.,

Рис. 1. Электрофореграммы (а) различных молекулярных форм иерсинина; (б) тримерных и (в) мономерных форм поринов из Y. enterоcolitica, Y. intermedia, Y. kristen­senii, Y. frederiksenii до нагревания (б - дорожки 5, 6, 7, 8; в - дорожки 1, 2, 3, 4 соответственно) и после нагревания при температуре 100С (б - дорожки 1,2, 3, 4; в - дорожки 6, 7, 8, 9 соответственно); дорожка 5 (в) – белки-стандарты.

Для тримеров иерсинина, полученных разными способами, были определены некоторые физико-химические параметры, характеризующие их макромолекулярную организацию. С помощью скоростной седиментации для Пор-SDS была выявлена гетерогенность по М. Так, на седиментограмме наряду с основным пиком с коэффициентом седиментации 7,2 S были обнаружены небольшие пики с коэффициентами седиментации 5,2 и 2,6 S. Напротив Пор-Lys в этих же условиях был гомогенен и имел коэффициент седиментации 7,2 S. Эта величина близка к таковой для тримера порина из E. coli. Эти данные позволяют предположить, что полипептиды 5,2 и 2,6 S представляют собой, соответственно, димер и мономер порина.

Сравнительный анализ пространственной структуры, выполненный с помощью методов оптической спектроскопии (КД и собственной белковой флуоресценции), показал, что Пор-SDS обладает менее фиксированной третичной структурой, нежели Пор-Lys. Это, вероятно, обусловлено нарушением (ослаблением) некоторых внутримолекулярных связей в белке, произошедшим в результате сочетанного действия SDS и температуры в процессе выделения.

Таблица 1. Термодинамические параметры Пор-SDS и Пор-Lys, образцов иерсиниа, выделенных разными способами

Образец иерсинина

ΔН кал

ΔG

ΔН эфф

ΔН кал./ ΔН эфф

Td, K

кДж/моль

Пор-SDS

300

9,5

133

2,25

362,2

Пор-Lys

395

11,8

125

3,16

355,4

Примечание: ΔНкал – калориметрическая энтальпия денатурации; ΔG – свободная энергия Гиббса; ΔНэфф – эффективная (Вант-Гоффа) энтальпия денатурации; Td- температура денатурации.

Этот вывод был подтвержден данными сканирующей микрокалориметрии. Как видно из данных табл. 1, величина свободной энергии перехода из нативного состояния в денатурированное, являющаяся мерой стабильности структуры белка, для Пор-SDS ниже, чем для Пор-Lys. Известно, что по отношению ΔН кал./ ΔН эфф можно судить о количестве в молекуле белка областей, плавящихся независимо друг от друга, так называемых энергетических доменов. Как видно из табл. 1, для тримеров иерсинина характерна доменная структура, включающая в себя 2-3 области. Можно предположить, что в случае Пор-SDS уменьшение числа доменов до 2-х свидетельствует о частичной денатурации белка.

Порины из НМ Y. enterocolitica и непатогенных энтероколитикоподобных видов иерсиний. Три вида непатогенных иерсиний (Y. intermedia, Y. kristensenii, Y. frederiksenii) выделяют в особую группу энтероколитикоподобных, так называемых “редких” иерсиний. Не существует единого мнения об участии Y. intermedia, Y. kristensenii, Y. frederiksenii в инфекционной патологии человека, однако, отдельные случаи иерсиниозов, вызываемые этими видами иерсиний, отмечены несколькими авторами.

При выделении поринов из НМ Y. enterocolitica и непатогенных видов иерсиний было обнаружено, что уже на первой стадии выделения (получение ПГ-белковых комплексов) происходят значительные потери белка за счет перехода его в супернатант. В связи с этим, выделение комплексов проводили при более низкой температуре (22 - 37С), а разрушение связи  ПГ-белок – при комнатной температуре. По данным SDS,ПААГ-электрофореза, фракции изолированных белков содержали две молекулярные формы поринов: тримерную и мономерную с М порядка 100-110 и 30 кДа соответственно. Очистку и разделение их проводили с помощью гель-хроматографии на сефакриле S-300. Полученные образцы белков были индивидуальны по данным SDS,ПААГ-электрофореза (рис.1 б и в), однако олигомеры поринов, подобно иерсинину, выявлялись на электрофореграмме в виде мультиплетных зон. Обе формы поринов, подобно таковым иерсинина, были термолабильны и при кипячении растворов белка превращались в денатурированный мономер с М 38 кДа (рис.1б и в). Согласно аналитическим данным образцы поринов содержали до 10% моносахаридов. N-Концевой аминокислотой поринов исследованных видов иерсиний, как и в поринах других энтеробактерий, являлся аланин.

Как известно, ограниченная растворимость и склонность к агрегации поринов вызывают серьезные затруднения при определении М этих белков методом SDS, ПААГ-электрофореза. Эти особенности, а также зависимость электрофоретической подвижности белков от конформации позволяют говорить только о кажущемся значении М поринов.

Значения М мономерных форм поринов из 5-ти видов иерсиний, определенные методом SDS, ПААГ-электрофореза, оказались близкими (табл. 2). Эти величины хорошо коррелировали с величинами, полученными с помощью масс-спектрометрии (MALDI-TOF модификация) и рассчитанными из аминокислотного состава белков.

Таблица 2. Молекулярные массы (М, кДа) термолабильной (мономер) и термостабильной (ТСБ мономер) молекулярных форм поринов НМ бактерий рода Yersinia

Бактерии/метод

SDS,ПААГ-

электрофорез

мономер

SDS,ПААГ-

электрофорез

ТСБ мономер

MALDI-TOF

ТСБ мономер

По данным

АК состава

белков

Y. pseudotuberculosis

35,5

40,0

не опред.

37,6

Y. enterocolitica

30,6

38,2

37,8

38,9

Y. intermedia

30,6

37,2

37,5

38,2

Y. kristensenii

29,8

38,4

37,5

38,4

Y. frederiksenii

30,7

38,6

37,5

37,1

       

На примере иерсинина было показано, что порин входит в состав эндотоксина, или классического антигена Буавена, извлекаемого из НМ микроорганизма раствором ТХУ, а также в состав ЛПБК, получаемого в более мягких условиях при эстракции НМ псевдотуберкулезного микроба водным н-бутанолом. Идентификацию иерсинина и белкового компонента ЛПБК проводили с помощью химического анализа. Иерсинин и белок 40 кДа имели близкий аминокислотный состав и идентичные пептидные карты продуктов триптического гидролиза (рис. 2).

Рис. 2. Пептидные карты продукта триптического гидролиза иерсинина (а) и белка 40 кДа из ЛПБК (б)

2. Первичная и пространственная структура поринов иерсиний

Дизайн типоспецифических OmpF-праймеров. Для амплификации нуклеотидных последовательностей генов OmpF поринов иерсиний были разработаны типоспецифические праймеры. С этой целью нами были проанализированы сигнальные пептиды известных OmpF- подобных белков энтеробактерий (E. coli, Serratia marcescens, Salmonella typhimurium, Salmonella typhi, Xenorhabdus nematophilus). Дополнительно был проведен поиск пориновых генов в геноме Y. pestis (Parkhill J., 2001) с помощью программных средств, поддерживаемых на сервере http://www.sanger.ac.uk/ Projects/Y_pestis/ (Institute Sanger, Великобритания). В качестве зондируемой последовательности была использована нуклеотидная последовательность ompF гена S. marcescens (NCBI, U81967), поскольку эта бактерия филогенетически наиболее близка к роду Yersinia. В результате была обнаружена последовательность гена (YO1411), обозначенная как putative OmpC porin, которая, как следует из названия, не относится к определенному типу неспецифических поринов НМ грамотрицательных бактерий. Анализ промоторной области YO1411 гена показал наличие мотивов, характерных для промоторов ompF–подобных генов энтеробактерий, а именно определенное расположение OmpR-связывающих сайтов и наличие последовательности, комплементарной к 4.5 S micF RNAs. Все это позволило идентифицировать YO1411 ген как ompF–подобный и использовать его для дизайна иерсиниозных OmpF- праймеров. Праймеры были сконструированы на основе участков гена YO1411.

Клонирование кодирующих последовательностей и анализ аминокислотных последовательностей OmpF поринов бактерий рода Yersinia. В результате ПЦР были получены ПЦР фрагменты для 5-ти видов иерсиний длиной приблизительно 1100 п.н., которые были клонированы в вектор pBluescript SK(-). Полученные плазмиды были секвенированы с помощью универсальных прямого и обратного М13-праймеров.

Первичные структуры поринов иерсиний были выведены из нуклеотидной последовательности соответствующих ompF генов. Сравнительный анализ аминокислотного состава поринов исследованных иерсиний был проведен с привлечением соответствующих данных для Y. pestis, взятых из банка Swiss-Prot (Q8ZG94). Аминокислотный состав поринов из НМ бактерий рода Yersinia был характерен для порообразующих белков НМ энтеробактерий. Отмечено значительное содержание кислых аминокислот, аспарагиновой и глутаминовой (индекс полярности белков 43-45%), отсутствие цистеина и низкое содержание лизина (не более 5%). Относительное содержание ароматических аминокислот в поринах оказалось достаточно высоким, около 13%. В состав мономеров исследованных поринов входит по 3 остатка триптофана и 26-27 остатков тирозина. Суммарное количество остатков таких пар аминокислот, как Lys-Arg, Asp-Glu, Ile-Leu для исследованных белков составляет порядка 30, 90, 30 соответственно. Эти значения близки значениям подобных сумм, рассчитанным для Omp F поринов энтеробактерий, в частности трех видов сальмонелл.

Для поринов патогенных иерсиний были определены теоретические изоэлектрические точки (ИЭТ) и рассчитаны М:  для OmpF Y. pseudotuberculosis эти величины составляют, соответственно, 4,45 и 37,7 кДа, а для OmpF Y. enterocolitica – 4,34 и 39,5 кДа. Эти значения М хорошо согласуются с соответствующими величинами, ранее полученными  экспериментально с помощью SDS, ПААГ-электрофореза и масс-спектрометрии MALDI-TOF (раздел 1, табл. 2).

Результаты сравнительного анализа аминокислотных последовательностей поринов иерсиний, в том числе взятых из GeneBank (NCBI), представлены в виде таблиц, отдельно по Y. pseudotuberculosis и Y. pestis (табл. 3) и по Y. enterocolitica и другим энтероколитикоподобным видам (табл. 4). Как видно из данных таблиц, наиболее близкими между собой видами являются Y. pseudotuberculosis и Y. pestis Степень гомологии этих поринов (до 95%) близка к таковой для внутривидового подобия: 98,6% - для серотипов Y. pseudotuberculosis  и 99,2% для сероваров Y. pestis. Эти данные подтверждают близкое эволюционное родство двух видов и гипотезу появления Y. pestis от Y. pseudotuberculosis.

Таблица 3. Степень гомологии между OmpF поринами Y. pseudotuberculosis и Y. pestis (в %)

Y. pseudotuberculosis

Y. pestis

Yps_3260

(1B)

Yps_32953

(1B)

Yp_C092

Yp_91001

(mediaevalis)

Yps_3260

100

98,6*

95,0

94,8

Yps_32953

100

93,6

93,4

Yp_C092

100

99,2

Yp_91001

100

Таблица 4. Степень гомологии между OmpF поринами Y. enterocolitica и другими энтероколитикоподобными видами иерсиний (в %)

Y. enterocolitica

Y. intermedia

Y. kristensenii

Y. frederiksenii

Ye_164

Ye_8081

Yi_253

Yk_991

Yf_4849

Ye_164

100

93,2

84,1

84,5

85,7

Ye_8081

100

80,6

82,1

82,4

Yi_253

100

88,3

84,6

Yk_991

100

84,6

Yf_4849

100

Таблица 5. Степень гомологии между OmpF-подобными поринами энтеробактерий (в %)

Y.pseudotuber

сulosis

Y. pestis

Y. enterocolitica

S. marcensens

E. coli

Y. pseudotuberculosis

100

95

83

70

55

Y. pestis

100

82

70

58

Y.enterocolitica

100

70

52

S. marcensens

100

57

E. coli

100

При сравнении поринов второй группы бактерий (табл.4) была обнаружена высокая степень гомологии первичной структуры между поринами 2-х разных штаммов Y. enterocolitica (93,2%). Для представителей других видов энтероколитикоподобных иерсиний процент гомологии аминокислотной последовательности исследванных белков составил 80,6 - 88,3%, что укладывается в допустимый интервал значений межвидового подобия.

При сравнительном анализе первичной структуры поринов патогенных иерсиний и OmpF белков других энтеробактерий (табл. 5) обнаружена достаточно высокая степень подобия поринов иерсиний с OmpF S.marcescens (70%) и значительно меньшая гомология с OmpF E.coli (52-58%). Следует отметить, что степень гомологии, выявленная при сравнении OmpF-подобных белков,хорошо согласуется с данными, полученными при сравнении последовательностей 16S генов рРНК энтеробактерий.

При множественном выравнивании аминокислотных последовательностей зрелых OmpF -подобных белков энтеробактерий (рис. 3) были обнаружены следующие закономерности. Во-первых, наблюдается наличие протяженных областей высокой и низкой гомологии, при этом консервативные участки приходятся на трансмембранные домены, а высоковариабельные участки на «внешние» петли OmpF E. coli. Во-вторых, отмечается очевидная закономерность в распределении гидрофобных аминокислот и консервативных аминокислотных остатков, в первую очередь, глициновых, тирозиновых и фенилаланиновых. Известно, что в поринах ароматические аминокислоты образуют два так называемых ароматических «пояса», один из которых находится на границе мембраны и периплазматического пространства, а второй на границе мембраны и внеклеточного пространства. Их функция заключается в удержании гомотримера в липидном слое мембраны.

Вторичная структура и трансмембранная топология OmpF-подобных белков иерсиний. Вторичная структура иерсиниозных поринов (рис. 3) была смоделирована при помощи программ, предназначенных для предсказания вторичной структуры (GOR, PredictProtein, Tmpred) с учетом данных рентгеноструктурного анализа, выполненного для OmpF E. coli. Исходя из топологической модели, построенной для OmpF E. coli, -тяжи формируют трансмембранные участки белка, а неупорядоченные структуры – петли. Распределение элементов вторичной структуры по полипептидной цепи исследованных поринов (рис.3) позволяет сделать следующие выводы. Как и следовало ожидать, -тяжи приходятся на высококонсервативные участки, а элементы неупорядоченной структуры – на высоковариабельные участки АК последовательности белков. Оказалось, что OmpF-подобные порины иерсиний состоят из 16 -тяжей и 8 «внешних» петель. Результаты сравнительного анализа первичной структуры петель представляют наибольший интерес, поскольку гомология консервативных трансмембранных участков АК последовательности белков ( -тяжей) составляет около 90% ( 7, 14, 16) и 100% ( 1, 6, 8, 13, 15), а гомология полипептидов в области петель – от 16% (петля L4) до 100% (петли L1, L3, L5).

YE        AEIYNKDGNKLDLYGKVDARHQFSDNAGQD-----GDESYVRFGFKGETQITDQLTGYGQWEYNV 60

YK        AEIYNKDGNKLDLYGKVDARHQFSSNAGQD-----GDESYVRFGFKGETQITDQLTGYGQWEYNI 60

YI        AEIYNKDGNKLDLYGKVDARHQFSDAKSQD-----GDETYVRFGFKGETQITDQLTGYGQWEYNV 60

YF        AEIYNKDGNKLDLYGKVDARHQFSDNAKQD-----GDKSYVRFGFKGETQITDQLTGYGQWEYNV 60

YPS        AEIYNKDGNKLDLYGKVDARHSFSDNNKQD-----GDKSYVRFGFKGETQITDQLTGYGQWEYNI 60

YP        AEIYNKDGNKLDLYGKVDARHSFSDNNKQD-----GDKSYVRFGFKGETQITDQLTGYGQWEYNI 60

SMA        AEIYNKDGNKLDLYGKVDGLHYFSKDKGND-----GDQTYVRFGFKGETQITDQLTGYGQWEYNV 60

ECF        AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNF 65

        β16`                β1                L1                β2       β3        

YE        QANHAESQGD-KGNKTRLGFAGLKFAEFGSLDYGRNYGVIYDVNAWTDMLPVFGGDSISNSDNYM 124

YK        QANNAEAQGA-DGNKTRLGFAGLKFAEFGSFDYGRNYGVIYDVNAWTDMLPVFGGDSISNSDNYM 124

YI        QANNAEAQEA-KGNKTRLGFAGLKFDQFGSLDYGRNYGVIYDVNAWTDMLPVFGGDSISNSDNYM 124

YF        QANNTEGGDAQDGNATRMGFAGLKFAEFGSFDYGRNYGVIYDVNAWTDMLPVFGGDSISNSDNFM 125

YPS        QANNAEDSGAQDGNATRLGFAGLKFAEFGSFDYGRNYGVIYDVNAWTDMLPVFGGDSISNSDNFM 125

YP        QANNAEDTGAQDGNATRLGFAGLKFAEFGSFDYGRNYGVIYDVNAWTDMLPVFGGDSISNSDNFM 125

SMA        QSNHAESQGTE-GTKTRLGFAGLKFADYGSFDYGRNYGVLYDVEGWTDMLPEFGGDTYTYSDNFM 124

ECF        QGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDT-AYSDDFF 129

               L2       β4                β5                        L3

YE        TGRSTGLATYRNTNFFGLVDGLNFALQYQGKNENDRSAVANGVYTGDNLKDQNGDGFGISSTYDI 189

YK        TGRSTGLATYRNQNFFGLVDGLNFALQYQGKNENGRDGLLST---------QNGDGFGLSSTYDI 180

YI        TGRSTGLATYRNTNFFGLVDGLNFALQYQGKNETGRDGLLTT---------QNGDGFGISSTYDI 180

YF        TGRSTGLATYRNTNFFGLVDGLNFALQYQGKNE—-RNGDVKE---------SNGDGFGIGSTYDL 179

YPS        TGRSTGLATYRNNNFFGMVDGLNFALQYQGKNDR------------SEVKEANGDGFGIGSTYDL 178

YP        AGRSTGLATYRNNNFFGLVDGLNFALQYQGKNDR------------SEVKEANGDGFGIGSTYDI 178

SMA        TGRTNGVATYRNNNFFGLVDGLNFALQYQGKNQN--DG--------RDVKKQNGDGWGISSTYDI 179

ECF        VGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNER------------DTARRSNGDGVGGSISYEY 182

               β6                β7                 L4                 β8        

YE        GYGVNFGAGFSSSNRTDQQKRFS-----TAEGDKAQAWNVGAKYDANNVYLAVMYAETQNMTPYG 249

YK        GYGVSFGAGYSTANRTTAQKNAHLNTTPSAEGDKAQAWNVGAKYDANNVYLAAMYAETQNLTPFG 245

YI        GYGVNFGAGFSSANRTTLQKDAHLTNSTFAEGDKAQAWNVGAKYDANNVYLAVMYAETQNLTPFG 245

YF        GYGVNFGAGYSTANRTTLQKD-----ASTAPGNQAQAWNVGAKYDANNVYLAVMYAETQNMTPYG 239

YPS        GNGINFGAGFSSSNRTLDQKYGS-----TAEGDKAQAWNVGAKYDANNVYLAVMYAETQNLTPYG 238

YP        GNGINFGAGFSSSNRTLDQKYGS-----TAEGDKAQAWNVGAKYDANNVYLAVMYAETQNLTPYG 238

SMA        GEGVSFGAAYASSNRTDDQKLRS-----NERGDKADAWTVGAKYDANNVYLAAMYAETRNMTPFG 239

ECF        -EGFGIVGAYGAADRTNLQEAQP-----LGNGKKAEQWATGLKYDANNIYLAANYGETRNATPIT 241

               β9                L5                β10                β11

YE        -DANDT-----------IANKTRDIEITAQYQFDFGLRPSLGYVQSKGKDLNA--NGDNQDLLKY 300

YK        -N—DG------------IANKTRDIELTAQYQFDFGLRPSLGYVQSKGKDLNN-NTDTNHDLLKY 295

YI        -EDS—------------VANKTRDIEITAQYQFDFGLRPSLGYVQSKGKDLNNAT-DDNHDLVKY 295

YF        -TVANT-----------IANKTRDLEITAQYQFDFGLRPSLGYVQSKGKDLNDAT-GDNHDLVEY 291

YPS        -FYDFT-----------IANKTRDIEITAQYQFDFGLRPSLGYVQSKGKDLNN--VDANHDLVKY 289

YP        -SFSDT-----------IANKTRDIEITAQYQFDFGLRPSLGYVQSKGKDLND--VDANHDLLKY 289

SMA        -GGNFTNTCAATENCGGFASKTQNFEVTAQYQFDFGLRPEVSYLQSKGKNLNVPGVGSDQDLVKY 303

ECF        NKFTNTSG---------FANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEG---IGDVDLVNY 294

               L6                 β12               β13                L7

YE        VSVGSYYYFNKNMSTYVDYKINLLDENDFTRANGLNTDDVVGVGLVYQF 349

YK        VSVGTYYYFNKNMSTYVDYKINLLDEDKFTRANGLNTDNVVGVGLVYQF 344

YI        VSVGSYYAFNKNMTTYVDYKINLLDEDNFTRNNNLMTDDVVGVGLVYQF 344

YF        VSVGSYYYFNKNMSTYVDYKINLLDEDTFTVKNGLNTDNVVGVGLVYQF 340

YPS        VSVGTYYYFNKNMSTYVDYKINLLDKDLFTEVNRIMTDDVVAVGLVYQF 338

YP        VSVGTYYYFNKNMSTYVDYKINLLDEDLLDKDNGLNTDNVVAVGLVYQF 338

SMA        VSVGTTYYFNKNMSTYVDYKINLLDDNDFTKATGIATDDIVGVGLVYQF 352

ECF        FEVGATYYFNKNMSTYVDYIINQIDSD---NKLGVGSDDTVAVGIVYQF 340

        β14                β15                L8          β16

Рис. 3. Множественное выравнивание аминокислотных последовательностей зрелых OmpF поринов иерсиний. Серым фоном выделены идентичные аминокислотные остатки. Жирным шрифтом выделены функционально значимые аминокислотные остатки, которые играют важную роль в размере поры. YE - Y. enterocolitica, YK - Y. kristenseni ,YI - Y. intermedia, YPS – Y. pseudotuberculosis YP - Y. pestis (Swiss-Prot Q8ZG94), SMA - S. marcescens (Swiss-Prot O33980), ECF –  E. coli (Swiss-Prot Po2931).

При сравнении OmpF поринов возбудителей чумы и псевдотуберкулеза обнаружено, что основные отличия между ними приходятся на петли L6 и L8. Скорее всего, именно они определяют основные антигенные различия этих белков. Как видно из рис. 3, петли поринов иерсиний отличаются не только первичной структурой, но и имеют различную длину. Наибольшими по длине являются: петля L1 OmpF E. coli, петля L4 OmpF Y. enterocolitica и петля L6 OmpF S. marcescens.

В стабилизации тримерной структуры огромное значение имеет петля L2. При анализе петель L2 поринов из Y. enterocolitica и S. marcescens обнаружено значительно большее сходство в АК последовательности этих участков (70% идентичности), чем между аналогичными участками OmpF белков Y.enterocolitica и других иерсиний (45% идентичности). Это, несомненно, свидетельствуют о филогенетическом родстве микроорганизмов Y. enterocolitica и S. marcescens.

Известно, что петля L3 проникает внутрь поры и участвует в механизме «открытия-закрытия» канала. Ключевыми аминокислотами во взаимодействии петли L3 с внутренней стенкой -барреля являются Lys-16, Arg-41, Arg-82, Arg-132 (-баррель) и Asp-113, Glu-117 (петля L3). Интересно, что все три порина иерсиний имеют одну и ту же замену в высококонсервативном пентапептиде PEFGG, где остаток Glu-117 заменен на Val-114/115. Остальные функционально значимые АК остатки у иерсиний были одинаковыми (рис.3).

Теоретическая модель пространственной структуры тримера иерсинина. Учитывая практически полную идентичность первичной структуры иерсинина и порина из Y. pestis, пространственные модели мономерных форм поринов Y. pseudotuberculosis (YPS), Y enterocolitica (YE) и Y. pestis (YPT) были построены с помощью метода гомологичного моделирования (с использованием серверов PredPort, 3DSSM и SWISS-MODEL). В качестве прототипа была использована 3-D структура Pho E порина из E. coli. Суперпозиция С атомов мономеров патогенных иерсиний и порина Pho E имела среднее квадратичное отклонение 0.47 и 0.43 (для YPS и YE соответственно). Нами также была построена модель тримера OmpF Y. pseudotuberculosis (рис. 4) с использованием в качестве матрицы пространственной структуры тримера порина OmpF E. coli (3HXX).

Рис. 4. Теоретическая модель пространственной структуры тримера и мономера порина

из Y. pseudotuberculosis (А) и мономера Y. enterocolitica (Б).

Обнаружено, что порины иерсиний по пространственной структуре очень похожи на неспецифические порины других энтеробактерий и имеют те же самые особенности как в общей укладке -стрэндов, так и в расположении петель, в частности петли L3, важной для функциональных свойств белка. Однако несмотря на высокую степень структурного подобия, у поринов иерсиний были обнаружены необычные замены в функционально значимых консервативных сайтах АК последовательности. Так, упомянутая выше замена Glu на Val в высоко консервативном пентапептиде (Pro-Glu-Phe-Gly-Gly-Asp), расположенном в средней части петли L3, «разрушает» функционально важный кластер кислых АК в зоне констрикции (сужения) поры. Наибольшие различия наблюдались в области внешних петель, например для петель L6 и L8 степень идентичности составляла только 71.4 и 52.9% соответственно. Экспонированные на поверхности эти петли поринов являются потенциальными линейными антигенными детерминантами и обуславливают иммунохимическое различие белков.

       Был проведен компьютерный анализ структурной организации Omp F E. coli и поринов патогенных иерсиний (Y. pseudotuberculosis и Y. pestis), а именно сайтов АК последовательности, участвующих в суъединичной ассоциации, формировании «просвета» поры и структуры ее внутренней части. В результате были обнаружены различия в полярном взаимодействии, играющем важную роль в стабилизации тримера белка, а также распределении отрицательных зарядов во внешнем «вестибюле» пориновых каналов. На основании этого с помощью программы HOLE была предсказана проводимость порина из Y. pseudotuberculosis. При сравнении теоретических и экспериментальных данных, полученных ранее для иерсинина, обнаружено хорошее соответствие значений проводимости канала, образуемого иерсинином в БЛМ.


3. Функциональная активность поринов иерсиний

Электрофизиологические свойства порина из НМ Y pseudotuberculosis (иерсинина). При добавлении иерсинина в водную фазу, окружающую БЛМ, мембранный ток изменялся дискретно с течением времени как для олигомерной, так и для мономерной формы белка (рис. 5).

Рис. 5. Флуктуации тока через БЛМ

(а) в присутствии олигомера иерсинина (10 нг/мл) и (б) ТСБ мономера (100 нг/мл). Водная фаза: 0,1 М NaCl в 10-2 М трис-HCl буфере, рН 8,0. Температура 25С. Сопротивление обратной связи 108 Ом.

Рис. 6. Гистограмма уровней проводимости, (а) индуцированной тримером иерсинина (20 нг/мл, n=157) и (б) ТСБ мономером (100 нг/мл, n=134).

Подобный характер изменения проводимости БЛМ может быть обусловлен только возникновением в ней пор. Наименьшие концентрации, при которых наблюдались флуктуации тока в БЛМ для обеих форм белка, отличались на два порядка: для олигомера - 0,1 нг/мл, для мономера - 10 нг/мл. Тем не менее, анализ уровней проводимости, индуцированной иерсинином, показал, что наиболее вероятные каналы, образованные обеими формами белка, имеют одинаковую проводимость, порядка 240 пСм (рис. 6). Это указывает на общий механизм порообразования под влиянием обеих форм иерсинина.

Специальные эксперименты показали, что вольт-амперная характеристика одиночного канала, индуцированного тримером иерсинина, линейна и симметрична относительно начала координат при изменении мембранного потенциала от -120 до +120 мВ. На рис.7 приведена запись изменения тока в БЛМ, индуцированного одной «работающей» порой. При потенциале больше 100 мВ обнаружено влияние знака мембранного потенциала на состояние одиночной поры: наблюдались быстрые отключения одиночного канала. Поскольку вероятность реконструирования белка при добавлении с обеих строн БЛМ была одинакова, нельзя точно сказать, потенциал какого знака инициирует «закрытие» канала.

Мембрана с большим числом пор также имела линейную вольт-амперную характеристику, поэтому ее свойства определяются свойствами одиночного канала. Диаметр такой поры можно оценить по формуле = σ π r2/ L, где – наиболее вероятный уровень проводимости поры, равный 240 пСм; σ - удельная электропроводность 0,1 М раствора NaCl, равная 10,6 мСм/см; L – длина канала, равная 7,5 нм. Диаметр поры иерсинина оказался равным 1,5 нм, что близко к величине диаметра пор других энтеробактерий.

Рис. 7 Зависимость проводимости одиночного канала иер-синина (0,1 нг/мл) от знака мембранного потенциала, приложенного к БЛМ.

Рис. 8. Зависимость интегральной проводимости БЛМ (через 10 мин после формирования мембраны) от концентрации тримера иерсинина (1) и ТСБ мономера (2). Каждая точка соответствует среднему из пяти измерений.

На рис.8 представлена зависимость интегральной проводимости БЛМ от концентрации иерсинина в двойном логарифмическом масштабе. Наклон прямой на таком графике интерпретируют как число субъединиц, участвующих в образовании проводящего комплекса. Как видно из рис. 8, для тримера порина эта величина равна 2, а для мономера – 1. Полученный результат можно объяснить включением в БЛМ либо двух тримеров одновременно, либо гексамеров иерсинина, образующихся в условиях проведения эксперимента. Возможно, при данной концентрации белка и/или выбранном рН буферного раствора иерсинин существует в виде агрегатов тримеров (см. ниже раздел 4). Таким образом, канал иерсинина по своим размерам и электрическим характеристикам подобен водонаполненным порам, образуемым в модельной мембране Omp F поринами энтеробактерий.

Порообразующие свойства изолированых поринов из Y. enterocolitica и энтероколитикоподобных иерсиний. При добавлении в водную фазу, окружающую БЛМ, изолированных тримеров поринов из НМ Y. enterocolitica и непатогенных видов иерсиний наблюдались дискретные флуктуации тока с присущим для порообразующих белков ступенчатым характером изменения проводимости модельной мембраны. Тримерные формы поринов проявляли высокую порообразующую активность в области концентраций 5-10 нг/мл, и величина наиболее вероятной проводимости канала зависела от мембранного потенциала (табл.6). Наибольшая проводимость обнаружена для каналов, образованных поринами из Y. frederiksenii (480 пСм) и Y. enterocolitica (400 пСм). Характерной особенностью пор, образованных тримерами белков из 3-х непатогенных иерсиний, являлось наличие 2-х популяций каналов с различным диаметром пор (табл. 6, рис.9.). Для порина из энтероколитики подобная гетрогенность каналов проявлялась только при увеличении потенциала на мембране.

Таблица 6. Проводимость и размер каналов, образованных поринами бактерий рода Yersinia при мембранном потенциале -20 и -50 мВ

Образец порина (10 нг/мл)

-20 мВ

-50 мВ

g,пСм

D, нм

G, пСм

D, нм

Y.enterocoltica

400

1,42

192, 240

0,99; 1,10

Y.intermedia

180, 360

0,96; 1,35

120, 172

0,78; 0,94

Y.kristensenii

180, 300

0,96; 1, 24

120, 192

1,10

Y.frederiksenii

180,480

0,96; 1,56

240

0,78;0,99

Согласно данным табл. 6, по величине пор, образуемых в модельной мембране, исследованные белки можно отнести к Omp F-подобным поринам НМ грамотрицательных бактерий, которые экспрессируются в мембране при низкой температуре и низком содержании солей в культуральной среде.

Рис. 9. Гистограммы уровней проводимости пор, образованных поринами НМ Y. intermedia (а), Y. enterocolitica (б), Y. kristensenii (в), Y. frederiksenii (г) в зависимости от мембранного потенциала: -20 мВ – черные колонки, -50 мВ – серые колонки, ширина колонок 24 пСм. По оси ординат указано число каналов (N), по оси абсцисс – проводимость пор (). Отмеченные уровни проводимости кратны мин. равной 80 пСм.

Анализ гистограмм распределения пор по проводимости для поринов из Y. intermedia, Y. enterocolitica, Y. kristensenii и Y. frederiksenii (рис. 9 и табл. 6), показал, что увеличение мембранного потенциала до -50 мВ приводило к уменьшению наиболее вероятного уровня проводимости каналов до 120 - 240 пСм. При этом в случае поринов из Y. intermedia и Y. kristensenii сохранялись две популяции каналов с различным диаметром пор, при этом доля пор малой проводимости, порядка 100 пСм, увеличивалась. Подобная закономерность была обнаружена для каналов, образованных Omp F поринами из E. coli, для которых увеличение мембранного потенциала приводило к дестабилизации пор большого диаметра.

4. Конформационная пластичность неспецифических поринов НМ грамотрицательных бактерий (на примере конформационных превращений иерсинина в присутствии денатурантов)

Согласно современным представлениям отдельные области олигомерной структуры порина отличаются устойчивостью к действию различных денатурирующих агентов. Это обстоятельство предопределяет множественность денатурированных состояний поринов, отличающихся между собой по конформации. Структура и функциональная активность этих конформационных интермедиатов изучены слабо, хотя информация такого рода необходима для понимания молекулярных механизмов транспорта веществ через пориновые каналы и особенностей фолдинга мембранных белков.

Пространственная структура молекулярных форм иерсинина, получаемых при солюбилизации мембраны, и различных денатурированных форм порина была охарактеризована с помощью методов оптической спектроскопии и сканирущей микрокалориметрии. Согласно литературным данным вторичная структура порина из E. coli в липосомальной мембране характеризуется повышенным содержанием β-структуры (80±5%) и почти полным отсутствием -спирали (не более 4%). Указанное выше соотношение элементов вторичной структуры мы рассматривали как своеобразную «точку отсчета», так как пространственная организация белка в искусственном бислое максимально приближена к таковой в нативной мембране.

Сравнительная характеристика пространственной структуры молекулярных форм поринов иерсиний. Как было сказано в разделе 1, образование ТСБ мономерных форм поринов иерсиний сопровождалось изменением величины кажущейся М в условиях SDS, ПААГ – электрофореза, что обусловлено конформационными изменениями на различных уровнях пространственной организации белка. Обнаружено, что спектры КД тримеров, мономеров и термоденатурированных мономеров поринов исследованных видов иерсиний в дальней (190-240 нм) и ближней (250-300 нм) УФ-областях различаются между собой, в то время как спектры соответствующих молекулярных форм поринов из разных видов иерсиний подобны. В качестве примера на рис. 10 представлены спектры КД поринов из Y. kristensenii.

Рис. 10. Спектры КД разных молекулярных форм порина НМ Y. kristensenii в ближней (250-300 нм) и дальней (190-240 нм) УФ-областях: термолабильные тример (1) и мономер (2), термоденатурированный моно-мер (3) в присутствии 0,25% SDS.

Анализ данных рис. 10 позволяет заключить, что при переходе тримерной формы поринов в денатурированный мономер регулярная  вторичная структура белков сохраняется, однако форма и амплитуда полос в спектре КД изменяется. Помимо минимума при λ = 218 нм, характерного для - структурированных белков, появляется второй минимум при λ = 207 нм, что свидетельствует об увеличении в полипептидной цепи порина доли α- спирализованных участков. Расчеты содержания элементов вторичной структуры исследованных поринов, выполненные с помощью метода Провенчера-Глокера для иерсинина (табл.7) и пакета программ CDPro для остальных поринов (табл. 8), подтверждают этот вывод. Так, по сравнению с тримером и мономером в полипептидной цепи ТСБ мономера иерсинина содержалось в 2-2,5 раза больше -спиральных участков и соответственно меньше -структуры (табл. 7). В случае поринов из энтероколитики и непатогенных иерсиний (табл. 8) наблюдалась та же тенденция, но для этой группы белков она более выражена и приводит к тому, что в отличие от тримеров, относящихся к полностью β- структурированным белкам, ТСБ мономеры этих поринов относятся к белкам α+β класса. Изменения в содержании неупорядоченной структуры в полипептидной цепи поринов из всех видов иерсиний оказались незначительными.

Таблица 7. Характеристика нативного и денатурированного иерсинина в присутствии различных детергентов

Детергенты

Флуоресценция λ возб., нм

КД, содержание элементов вторичной структуры

0,1 %  SDS

Образец белка

280

296

α-спираль

β-структура

β-изгиб

не упорядочен

­ная структура

Тример до нагревания

322±2

328±2

15

42

14

21

Мономер до нагревания

327±1

328±2

12

48

21

19

Тример после нагревания

315±1

337±1

32

34

14

20

0,2 %  ОГ

Тример до нагревания

326±2

330±2

4

48

23

25

Тример после нагревания

334±1

337±1

2

51

23

24

       Согласно данным спектров КД поринов в ближней УФ-области третичная структура поринов исследованных видов иерсиний оказалась более чувствительной к действию температуры. Помимо потери жесткости пространственной организации белковой молекулы в целом ТСБ мономеры отличались от тримеров и по микроокружению ароматических флуорофоров. Следует отметить несколько большую устойчивость третичной структуры иерсинина по сравнению с таковой других исследованных поринов (за исключением белка из Y. frederiksenii) к действию температуры. Для термоденатурированных мономеров поринов из Y. pseudotuberculosis и Y. frederiksenii наблюдался наименьший сдвиг максимума спектра суммарной флуоресценции в коротковолновую область спектра (до 315±1 нм) по сравнению со спектрами других поринов (до 310±2 нм).

Таблица 8. Содержание элементов вторичной структуры поринов из Y. intermedia (Y.i), Y. enterocolitica (Y.e.), Y. kristensenii (Y.k.), Y. frederiksenii (Y.f.), расcчитанное по спектрам КД с помощью пакета программ CDPro

Образец порина*

α-спираль

β-структура

β-изгиб

неупорядоченная

структура

Y.i. тример

Y.e.тример

Y.k. тример

Y.f. тример

Y.i. ТСБ мономер

Y.e. ТСБ мономер

Y.k.ТСБ мономер

Y.f. ТСБ мономер

0.17

0.08

0.07

0.08

0.22

0.30

0.15

0.38

0.33

0.32

0.42

0.34

0.17

0.30

0.37

0.20

0.24

0.27

0.21

0.26

0.27

0.29

0.19

0.12

0.26

0.33

0.30

0.32

0.30

0.29

0.29

0.30

* - образец порина в 10-2 М трис–HCl буфере, pH 7,4, 0,25% SDS.

       Как известно, это явление носит название «голубого сдвига» максимума суммарной эмиссии белка и обусловлено увеличением вклада остатков тирозина в суммарное излучение белка за счет увеличения расстояния между ароматическими флуорофорами и/или тушения их флуоресценции растворителем при экспонировании на поверхности белковой глобулы. (табл. 7 и 9)

Таблица 9. Параметры спектров флуоресценции поринов Y. intermedia (Y.i), Y. enterocolitica (Y.e), Y. kristensenii (Y.k), Y. frederiksenii (Y.f.).

Образец порина*

λвозб., нм

λмакс ,нм

I фл.отн.ед.

Δλ1/2, нм

R

( I320 / I 350)

Y.i  тример.

280

296

328±2

337±1

224.3

66.0

63

64

1.35

0.94

Y.e  тример.

280

296

330±1

340±2

142.2

49.1

64

72

1.29

0.75

Y.k. тример

280

296

330±1

335±2

215.2

62.1

61

59

1.30

0.97

Y.f. тример

280

296

330±1

337±2

181.3

52.8

61

61

1.32

0.93

Y.i. ТСБ

мономер

280

296

310±1

339±1

138.9

46.6

78

67

1.28

0.82

Y.i.ТСБ

мономер

280

296

312±1

340±1

96.1

34.9

69

70

1.20

0.8

Y.k.ТСБ

мономер

280

296

310±1

341±2

90.2

33.8

73

72

1.13

0.67

Y.f ТСБ

мономер.

280

296

315±1

337±1

127.9

41.8

74

64

1.28

0.87

Примечание: * образцы поринов в 10-2 М трис–HCl буфере, pH 7,4, 0,25% SDS.

На примере иерсинина было показано существенное влияние природы используемого для экстракции поринов детергента на пространственную структуру белка. Как видно из данных табл. 7, в присутствии неионного детергента ОГ пространственная структура порина максимально приближена к таковой в липосомальной мембране, то есть к нативной, и обладает большей стабильностью по отношению к температуре.

Температурная денатурация поринов иерсиний. Влияние температуры на пространственную структуру тримеров поринов иерсиний было исследовано в динамике в диапазоне температур 20-90С. Согласно данным SDS,ПААГ-электрофореза нагревание тримеров не приводит к появлению мономерной формы белка, наблюдаемой в процессе выделения поринов, а только к образованию денатурированного мономера (рис. 11).

Рис. 11. Электрофореграмма тримеров поринов Y. enterocolitica при различной температуре: 1 - 25-40С, 2 - 45С, 3 - 50С, 4 - 55С, 5 - 60С, 6 - 65С, 7 - 70С, 8 - 80С, 9 - 90С.

Этот результат позволяет предположить, что при термоденатурации поринов, представляющей собой двухстадийный процесс (диссоциация - денатурация), скорости конформационных превращений, происходящих на каждой из стадий, существенно отличаются. Другим объяснением может быть такой вариант, когда диссоциация тримера на мономеры происходит одновременно с денатурацией мономерной формы белка.

Рис. 12. Графики изменения макс суммарной флуоресценции (возб. 280 нм) поринов из Y. intermedia (кривая 1), Y. enterocolitica (кривая 2), Y. kristensenii (кривая 3), Y. frederiksenii (кривая 4) в зависимости от температуры.

Как показали наши исследования, при нагревании до 50С денатурация поринов была обратимой, а в интервале 50-70С наблюдался конформационный переход (рис. 12,13). Об этом свидетельствовало резкое изменение положениий максимумов спектров эмиссии белка при обеих длинах волн возбуждения, что указывает на появление качественно нового состояния порина - денатурированного мономера (ТСБ мономера). Температура конформационного перехода, определяемая как средняя точка S-образной кривой (отображающей термозависимость макс. спектров флуоресценции белков) для поринов разных видов иерсиний оказалась различной. В случае порина НМ Y. enterocolitica термопереход происходил при 55С, что на 7-10С меньше по сравнению с термопереходами поринов из непатогенных видов иерсиний (62-65С). Самым термоустойчивым из поринов оказался иерсинин, который необратимо денатурировал при 76С. За точкой термоперехода поринов (в диапазоне от критической температуры до 90С) параметры спектров суммарной эмиссии белков не изменялись. Согласно данным рис. 13, порин из Y. kristensenii в отличие от поринов других видов иерсиний претерпевает два температурных перехода (при 50 и 70С), причем оба носят кооперативный характер.

В спектрах триптофановой флуоресценции термоденатурированных мономеров поринов наряду с основными полосами, приведенными в табл. 7 и 9, наблюдалось «плечо» при 350±1 нм (для иерсинина и поринов НМ непатогенных иерсиний) и 355±1 нм (в случае порина НМ Y. enterocolitica), что свидетельствует о появлении остатков триптофана, доступных растворителю. Очевидно, вследствие конформационных изменений в пространственной структуре поринов под влиянием температуры только часть остатков триптофана оказывается на поверхности белковой молекулы, а другая остается в гидрофобном окружении, в структурном домене, устойчивом к действию температуры.

Рис. 13. Графики изменения макс триптофановой флуоресценции (возб. 296 нм) поринов из Y. intermedia (1) Y. enterocolitica (2), Y. kristensenii (3), Y. frederiksenii (4) в зависимости от температуры.

Конформационные переходы иерсинина при изменении значений рН среды.

Денатурация иерсинина в кислой среде. Изменения в структуре иерсинина, происходящие под влиянием значений рН (в диапазоне 8,0-2,0) на уровне третичной и вторичной структуры белка, определяли методами сканирующей микрокалориметрии, флуоресцентной спектроскопии и КД. С помощью SDS,ПААГ-электрофореза оценивали  изменение молекулярной структуры иерсинина. Для анализа изменений в функциональной активности иерсинина использовали технику БЛМ.

Динамика изменений молекулярной структуры иерсинина при изменениии значений рН среды от 8,0 до 2,0 (рис. 14) показала, что уже при рН 4,5 наряду с тримерной формой иерсинина в образце присутствует мономер белка, а в интервале значений  рН 3,5-2,0 иерсинин существует только в мономерной форме. Значение ее кажущейся М составляло около 40 кДа, что, как было показано ранее, соответствует М денатурированного мономера иерсинина. На основании этих данных можно утверждать, что с увеличением концентрации ионов Н+ в растворе белка происходит диссоциация тримеров порина.


Рис. 14. SDS,ПААГ–электрофорез образцов иерсинина, полученных при рН-титровании (дорожки 2-8): 2 – рН 7,5; 3 – рН 6,3; 4 – рН 5,8; 5 – рН 5,0; 6 – рН 4,5; 7 – рН 3,5; 8 – рН 8,0 2,0; 1 – белки–маркеры (М, кДа): ингибитор трипсина (20), карбогидраза (30), яичный альбумин (45), бычий сывороточный альбумин (67), фосфорилаза В (94).

Присутствие только денатурированного мономера свидетельствует, скорее всего, о том, что и в кислой среде, подобно температурной денатурации (см.выше) разрушение молекулярной целостности тримера порина сопровождается одновременной денатурацией составляющих его мономеров. Об этом же свидетельствует изучение термостабильности иерсинина с помощью сканирующей микрокалориметрии при различных значениях рН. Как показали наши исследования, иерсинин при рН 7,6 имел четко выраженный термопереход при температуре 75С. При нагревании раствора порина при рН 3,5 и 2,2 характерное плавление образцов не наблюдалось. В связи с этим можно предположить, что изменения в пространственной структуре иерсинина под действием кислоты приводят к значительным нарушениям молекулярной организации порина на уровне третичной структуры белка.

На рис.15 приведены рН-зависимости параметров спектров флуоресценции (I, λmax, Δλ1/2, R) иерсинина.  Характер изменения этих параметров свидетельствует о том, что при рН-титровании порин образует целый ряд переходных конформационных состояний. В интервале значений рН 7,5–4,5 минимумы и максимумы кривых рН-зависимости отдельных параметров спектров флуоресценции (при обеих длинах волн возбуждения) не всегда совпадают. Это, скорее всего, свидетельствует о некооперативном характере изменений в структуре белка, которые связаны с постепенным изменением микроокружения ароматических флуорофоров по мере увеличения доли протонированных кислых аминокислотных остатков в белке.  Анализ кривых, приведенных на рис. 15, позволяет выделить две области структурных перестроек в молекуле иерсинина: в интервале значений рН 8,0–5,0 (со средней точкой при рН 6,5–6,0) и в интервале значений рН 4,0–2,0 (со средней точкой при рН 3,5–3,0). При низких значениях рН (4,0–2,0) изменение суммарного заряда молекулы порина сопровождается более значительными нарушениями в локальной третичной структуре иерсинина, что приводит к диссоциации тримера белка на мономеры. Конформация иерсинина при рН 4,5 соответствует некоему переходному состоянию белка, которое, очевидно, предшествует более выраженным структурным изменениям в молекуле порина под действием рН. Как было показано ранее (раздел 2), теоретическая изоэлектрическая точка иерсинина лежит именно в этой области и равна 4,45. Как известно, вблизи изоточки белки агрегируют, и, как правило, это сопровождается резким увеличением тушения  флуоресценции белка. Действительно, при рН 4,5 мы наблюдали наибольшую интенсивность Релеевского рассеяния в УФ спектре иерсинина.

Рис. 15. рН–Зависимости параметров спектров флуоресценции иерсинина.

Как видно из данных табл.10, максимум суммарной эмиссии порина при рН 2,0 смещается в коротковолновую область вплоть до 310 нм, а в спектре триптофановой флуоресценции белка, наряду со сдвигом максимума спектра в длинноволновую область на 5 нм, появляется плечо при λ=343±5 нм. Подобные изменения в спектре триптофановой флуоресценции белка мы наблюдали и при повышении температуры раствора порина (см. выше раздел 4), приводящей к уменьшению эффективности передачи энергии флуоресценции от тирозина к триптофану. Действительно, наши расчеты, показали, что для слабоосновных и слабокислых растворов иерсинина эти величины составляют 0,5 и 0,35 соответственно. К такому же выводу приводит и сравнительный анализ относительного вклада различных спектральных форм триптофана в суммарное излучение иерсинина при разных значениях рН. Оказалось, что спектры флуоресценции иерсинина описываются суммой вкладов форм S и II.1 В интервале значений рН 7,5–3,5 вклады этих форм практически равновелики (в среднем 0,51 и 0,49 соответственно), а при рН 2,5–2,0 вклад индольного хромофора, находящегося на поверхности белка в контакте с молекулами связанной воды, увеличивается до 0,60 и, соответственно, уменьшается вклад остатков триптофана, локализованных в гидрофобной части -барреля.

Для выяснения, насколько обратим процесс денатурации порина в кислых условиях, раствор белка при рН 2,0 был оттитрован до рН 8,0. Как следует из данных SDS,ПААГ-электрофореза (рис.14), тример порина при этом не образуется. Полученный интермедиат белка является мономером, но его локальная третичная структура отличается от конечного продукта «прямого» рН-титрования (табл. 10).

       Таблица 10. Параметры спектров флуоресценции рН - индуцированных интермедиатов порина из псевдотуберкулезного микроба

Образец иерсинина*

λвозб, нм

λмакс, нм

Iфл,отн. ед.

Δλ1/2, нм

R (I320/I350)

рН 7,5

280

296

324±2

332±1

339,1

84,8

59

60

1,54

1,19

рН 6,5

280

296

322±3

332±1

356,5

92,0

59

59

1,56

1,19

рН 4,5

280

296

320±1

332±1

300

74,3

59

58

1,6

1,22

рН 3,0

280

296

319±1

335±2

321,7

83,5

60

61

1,64

1,15

рН 2,0

280

296

309±1

337±2

343±2

236,9

44,9

73

55

1,90

1,11

рН 2,0 рН 7,5

280

296

336±1

343±1

202,1

36,5

64

66

0,92

0,68

Примечание: *тример иерсинина (50 мкг /мл) в 10-2 М фосфатно-цитратном буфере.

Рис. 16. Спектры кругового дихроизма образцов иерсинина в растворах при разных значениях рН: в ароматической (а) и пептидной (б) областях спектра.

На рис. 16 б приведены спектры КД иерсинина в пептидной области в интервале значений рН от 7,5 до 2,0. Увеличение концентрации ионов Н+ в растворе иерсинина приводило к уменьшению эллиптичности полос в ближней УФ-области спектра КД (рис. 16а). Это является следствием увеличения степени симметричности окружения ароматических аминокислотных остатков и, соответственно, уменьшения жесткости третичной структуры белка. В интервале значений рН от 7,5 до 3,5, т.е. до завершения диссоциации тримера белка, эти изменения незначительны. Так, эллиптичность спектра белка при рН 4,5 по сравнению с таковой исходного порина уменьшается всего на 20%. В то же время для иерсинина при рН 3,0 наблюдается существенное уменьшение (в 2,5 раза) эллиптичности полосы при =274 нм по сравнению с таковой в спектре исходного белка. В табл. 11 представлено содержание элементов вторичной структуры иерсинина в зависимости от рН, рассчитанное по методу Провенчера-Глокера. Как видно из данных табл., при низких значениях рН наблюдается существенное (до 50%) уменьшение содержания регулярной структуры, преимущественно β-типа, Наибольшее увеличение α-спиральных участков в полипептидной цепи белка отмечено в интервале значений рН 4,0–3,0, а резкое увеличение содержания неупорядоченной структуры с одновременным уменьшением β-структуры происходит в интервале значений рН 3,0–2,0.

Таблица 11. Содержание элементов вторичной структуры образцов порина из псевдотуберкулезного микроба по спектрам КД

№ п/п

Образец иерсинина*

α-спираль

β-

Структура

β-

изгиб

неупорядоченная

структура

1.

рН 7,5

0,14

0,50

0,12

0,24

2.

рН 4,5

0,14

0,45

0,19

0,22

3.

рН 3,0

0,24

0,35

0,12

0,30

4.

рН 2,0

0,26

0,18

0,03

0,54

5.

рН 2,0→8,0

0,18

0,34

0,23

0,26

Примечание *белок (150 мкг/мл) в фосфатно-цитратном буфере (10-2М, рН 7,4)

Денатурация иерсинина в щелочной среде. Мы провели исследование конформационной стабильности иерсинина в диапазоне значений рН 12,0-13,0. Оказалось, что при инкубировании белка при рН 12,3 и выше, его регулярная вторичная структура не претерпевает заметных изменений. Обнаружено, что структура «щелочного интермедиата» порина зависела от исходного состояния белка в образце, которое, как было показано ранее (раздел 1), определяется способом его солюбилизации. Расчеты элементов вторичной структуры порина, выполненные по спектрам КД с помощью пакета программ CDPro, показали, что под действием щелочи в полипептидной цепи порина с более «разрыхленной» структурой, полученного при солюбилизации НМ псевдотуберкулезного микроба с помощью SDS (Пор-SDS), увеличивается доля нерегулярной -спирали. Наблюдаемые изменения в структуре иерсинина необратимы. В то же время структура тримеров иерсинина с компактной нативоподобной структурой, полученных при расщеплении ПГ слоя лизоцимом (Пор-Lys), практически не изменяется. Очевидно, агрегация белковых макромолекул в растворе, свойственная данному образцу порина, повышает его устойчивость к действию щелочи. Конформационные превращения белка в данной области рН инициируются, по-видимому, ионизацией остатков тирозина.

Конформационные превращения иерсинина под действием мочевины. При исследовании процесса «разворачивания» иерсинина под действием мочевины (от 0 до 8 М) обнаружено, что денатурация белка влияет на спектры эмиссии белка при обеих длинах волн возбуждения. В спектрах суммарной и триптофановой флуоресценции порина наблюдался батохромный сдвиг эмиссии ароматических флуорофоров. При этом изменение положения максимумов флуоресценции в обоих случаях носило ступенчатый характер. Этот факт свидетельствует о множественности конформационных состояний порина при постепенном увеличении концентрации мочевины в растворе белка.

По данным SDS,ПААГ-электрофореза и спектроскопии КД в ароматической области спектра, в присутствии 4,5 М мочевины порин сохранял тримерную структуру. Последующее увеличение концентрации мочевины в растворе белка приводило к существенному ослаблению связей между мономерами в тримере порина вплоть до полной диссоциации тримера белка (при 7,0 М мочевины). Для интермедиата порина в присутствии 8 М мочевины характерна  максимальная доступность остатков триптофана растворителю (максимум эмиссии этого флуорофора находился при 350 нм).

Анализ спектров КД в «пептидной области» показал, что в присутствии 4,5 М мочевины существенных изменений в соотношении элементов вторичной структуры белка не происходит. В полипептидной цепи мономера порина, полученного при диссоциации тримера белка под действием мочевины, увеличивалось содержание α-спиральных участков и неупорядоченной структуры. Эти изменения наблюдались в разбавленных растворах порина (до 60 мкг/мл), в более концентрированных растворах (выше 100 мкг/мл) нарушение соотношения элементов вторичной структуры порина было минимальным.

Характеристика рН-индуцированных конформационных интермедиатов иерсинина. Физико-химическая характеристика отдельных рН-индуцированных интермедиатов иерсинина была проведена методами флуоресцентной спектроскопии и КД. Суммарная эмиссия изолированных тримеров иерсинина характеризуется существенным вкладом флуоресценции тирозина. На рис. 17 приведены спектры флуоресценции иерсинина при рН 7,5 при обеих длинах волн возбуждения (280 и 296 нм), нормированные таким образом, чтобы в длинноволновой части формы спектров совпадали, поскольку при 370 нм вклад флуоресценции тирозина отсутствует, а вклад триптофанилов не изменяется. Полученная разница в спектрах дает вклад флуоресценции тирозина в суммарное излучение белка. Проведенные нами исследования показали, что появление «голубого сдвига» в спектре суммарной эмиссии белка в результате повышения концентрации ионов Н в растворе связано с тем, что в этих условиях значительно увеличивается относительный вклад излучения тирозина: при рН 2,0 вклад триптофана уменьшается на 20%, а вклад тирозина только на 5%.

Фазовый график флуоресценции иерсинина, приведенный на рис. 18, имеет два излома: при рН 6,5 и при рН 3,0. Следовательно, именно этим значениям рН соответствуют два промежуточных состояния порина в ходе рН-титрования. Этот результат согласуется с данными других методов исследования молекулярной структуры порина. По данным SDS,ПААГ-электрофореза в процессе рН-титрования при рН 6,5 наблюдалось разрушение ассоциатов порина, а при рН 3,0 происходила диссоциация тримеров белка. При рН 6,5 с помощью техники БЛМ мы фиксировали уменьшение кооперативности включения белка по сравнению с порином в буфере с рН 8,0-7,5.

Рис. 17. Нормированные спектры флуорес­ценции иерсинина при обеих длинах волн возбуждения.

Рис. 18. Фазовый график рН-зависимости и интенсивности флуоресценции иерсинина.

С помощью тушителей различной природы (ионных и гидрофобных) было проведено картирование микроокружения остатков триптофана в иерсинине, изменяющегося в завимости от величины рН среды .

Рис. 19. Зависимость скорости тушения собственной флуоресценции иерсинина от величины рН среды, заряда и гидрофобности тушителя. В качестве тушителей флуоресценции использовались иодистый калий (а), хлористый цезий (б), диметилхалкон (в) и 1-фениламинонафталин (г).

Как видно из рис. 19, кривые, выражающие зависимости величин констант тушения этого флуорофора от величины рН, полученные при взаимодействии порина как с ионными тушителями, так и гидрофобными тушителями при значении рН около 4,5, проходят, соответственно, через минимум или максимум. Это свидетельствует об образовании у иерсинина в этой области значений рН некоего переходного конформационного состояния. Судя по величине констант Штерна-Фольмера (рис. 19, а и б), остатки триптофана в образце порина при рН 4,5 характеризуются малой доступностью для ионов цезия и иода. Тем не менее, значение Ктуш. для иодистого калия примерно в 6 раз выше, чем значение Ктуш. для хлористого цезия, т.е. в окружении остатков триптофана в белке при этом значении рН преобладают положительно заряженные группы. В случае гидрофобных положительно заряженных акцепторов флуоресценции – ДМХ и ФНА (рис. 19 в и г), в слабощелочной и кислой областях шкалы значений рН константы тушения флуоресценции порина этими тушителями соответственно в 2,5–3 раза выше, чем для интермедиата порина при рН 4,5. Кроме того, как видно из рис. 19, в, кривая тушения флуоресценции триптофана ДМХ имеет два максимума: один при рН 6,5, а другой в кислой области значений рН (в интервале рН 3,0–2,0). При этих же значениях рН мы наблюдали увеличение интенсивности флуоресценции иерсинина. Очевидно, как разрушение четвертичной структуры иерсинина (диссоциация ассоциатов тримера при рН 6,5, так и диссоциация тримеров белка на мономеры) сопровождается увеличением числа гидророфобных сайтов в микроокружении остатков триптофана, доступных гидрофобным акцепторам излучения белка.

Для выявления характерных особенностей вторичной структуры конформационных интермедиатов порина, образующихся в процессе рН-титрования иерсинина, мы воспользовались современным пакетом программ CDPro. Расчеты, выполненные с помощью  этой программы, позволяют определить не только содержание отдельных элементов вторичной структуры белка, но и соотношение регулярной и нерегулярной структуры каждого из элементов. Кроме того, можно определить количество сегментов отдельных элементов вторичной структуры белка, приходящихся на 100 АК остатков, и длину этих сегментов. Совокупный анализ изменений выше указанных величин в процессе денатурации белка позволяет судить о возможном механизме разворачивания его полипептидной цепи.


Таблица 12. Расчет содержания элементов вторичной структуры по программам CDPro

рН

r

  d

r

d

изгиб

неупоряд. cтруктура

7,5

0,100

0,120

0,137

0,086

0,24

0,316

4,5

0,063

0,161

0,093

0,101

0,257

0,424

3,0

0,124

0,133

0,123

0,075

0,232

0,313

2,5

0,114

0,128

0,113

0,073

0,231

0,34

8,0 2,0

0,090

0,102

0,139

0,091

0,22

0,358

Примечание: r , r регулярные спирали, структуры;

d , d нерегулярные спирали, структуры.


Как следует из данных табл.12, конформационное состояние иерсинина при рН 4,5 можно квалифицировать как переходное. Оно характеризуется наименьшим количеством регулярной -структуры, наибольшим количеством как -изгибов, так и неупорядоченной структуры. Последнее может служить свидетельством нестабильности молекулы порина в этих условиях. Согласно литературным данным в процессе изменения конформации прионовых белков образованию их фибриллярной нейротоксичной формы предшествует появление конформации прионов, обогащенной -изгибами. С другой стороны, для порина при рН 4,5 характерно максимальное число -структурированных фрагментов и их минимальная  длина (табл. 13). Это может быть свидетельством увеличения количества межмолекулярных -связей, что подтверждает образование агрегатов порина в этих условиях.


Таблица 13.  Расчет среднего количества и средней длины сегментов элементов вторичной структуры по программам CDPro


pH

7,5

4,5

3,0

2,0

α

2,43

1,44

2,72

2,54

β

4,21

5,21

4,25

3,93

α

7,34

6,12

7,94

8,11

β

4,95

4,49

5,14

4,93

Примечание: - среднее количество элементов вторичной структуры, приходящихся на 100 АК остатков;- средняя длина сегмента элементов вторичной структуры.

Мономерные формы иерсинина, образующиеся при рН 3,0 и 2,0, имеют существенные отличия в содержании элементов вторичной структуры белка (табл.12). Кроме того, как видно из табл.13, для мономера при рН 3,0 характерно  максимальное число -спиральных участков, а мономер при рН 2,0 имеет максимальную их длину и минимальное количество -структурированных фрагментов. Эти данные, а также тот факт, что доля неупорядоченной конформации в составе порина при рН 2,0  возрастает почти вдвое, позволяют предположить, что при денатурации порина в присутствии кислоты по крайней мере половина полипептидной цепи белка, образующей -баррель, разворачивается. При этом -стрэнды до значения рН 3,0 трансформируются преимущественно в -спиральные участки, а в интервале рН 3,0-2,0 — в неупорядоченную структуру.

Изменение амфифильности поверхности иерсинина при рН-титровании (взаимодействие с пиреном). Известно, что тонкая структура флуоресценции пирена зависит от полярности его микроокружения: соотношение интенсивностей излучательных полос при 393  и 372 нм (393/372) увеличивается с уменьшением полярности окружения. Зависимость этого параметра от величины рН (в диапазоне 8,0–2,0) для пирена в растворе тримера иерсинина приведена на рис.20.

Рис. 20. Влияние величины рН на микроокружение пирена в тримере иерсинина.

Как видно из рис. 20, в кислой и нейтральной областях значений рН поверхность молекулы тримера порина гидрофобна. При рН 4,3 связанный с белком пирен имеет минимальное значение вышеуказанного характеристического соотношения, что предполагает его полярное окружение. С учетом особенностей молекулярной организации β-структурированных белков можно предположить, что при значениях рН раствора белка 3,0 и 7,0–8,0 гидрофобные сайты полипептидной цепи -барреля порина, специфичные для взаимодействия с пиреном, максимально доступны. Тот факт, что величина соотношения R для порина при рН 3,0 больше, чем для белка в нейтральной и слабощелочной областях шкалы значений рН, возможно, объясняется нарушением плотности упаковки -барреля порина в кислой среде. Напротив, при рН 4,3 пространственная организация иерсинина соответствует, очевидно, конформации белка с минимально доступными для пирена сайтами связывания.

Согласно литературным данным максимальное значение соотношения R является признаком состояния расплавленной глобулы, а его минимальное значение характерно для нативного и денатурированного состояния белка. В соответствии с этим при анализе кривой рН-титрования иерсинина в присутствии пирена (рис. 20) можно выделить три различных конформационных состояния молекулы белка, соответствующих минимуму (при рН 4,3), максимуму (при рН 3,0) и среднему значению соотношения 393/372 (при рН 7,0–6,5). Интермедиат иерсинина при рН 4,5, как было сказано выше, по данным КД спектроскопии представляет собой некое промежуточное состояние белка с минимальным содержанием регулярной -структуры и наибольшим количеством -изгибов. Для иерсинина при рН 3,0 характерно, с одной стороны, значительное уменьшение степени упорядоченности окружения боковых цепей белка, а с другой, максимальное увеличение аффинности взаимодействия с гидрофобными акцепторами излучения белка (рис. 19, в, г). Таким образом, по степени разрушения третичной структуры белка и по эффекту взаимодействия с гидрофобными флуоресцентными зондами (сравнимым с экспонированием «гидрофобных карманов» при разворачивании водорастворимых белков), молекулярная организация иерсинина при рН 3,0 более всего удовлетворяет конформационному интермедиату белка, подобному расплавленной глобуле.

Иерсинин при рН 2,0 (конечный продукт воздействия кислоты на порин в исследованном диапазоне значений рН) по степени упорядоченности третичной структуры белка практически подобен порину при рН 3,0  однако по содержанию регулярной вторичной структуры отличается от него. Учитывая эти данные, интермедиат белка при рН 2,0 можно рассматривать как одну из форм конформационных состояний порина, образующихся в кислых условиях. В литературе известны подобные примеры образования при рН-титровании интермедиатов белков, отличающихся друг от друга по степени структурирования молекулы. Например, при исследовании денатурации стафилококковой нуклеазы наблюдалось образование различных компактных денатурированных форм этого фермента. Более структурированную форму стафилококковой нуклеазы авторы квалифицировали как расплавленную глобулу, а интермедиат, отличающийся меньшей степенью компактности и большей степенью разрушения вторичной структуры белка, как конформационное состояние белка, предшествующее расплавленной глобуле.

В связи с вышесказанным, можно предположить, что конформационные изменения молекулы порина под действием кислоты в интервале значений рН 8,0–5,0 подобны разворачиванию мультидоменных водорастворимых белков, образующих в процессе денатурации целый ряд конформационных интермедиатов, которые имеют различную третичную структуру белка. Совокупность полученных данных позволяет представить конформационные изменения порина из псевдотуберкулезного микроба под действием изменения кислотности среды в виде следующей схемы:

рН 8,0 - 7,5        рН 7,0 6,0        рН 4,5                рН 3,5                рН 2,0

N                PDI-1                PDI-2                A1                A2

± 0                kMG

Согласно литературным данным, особенностью фолдинга поринов, имеющих структуру типа -бочонка (в отличие от глобулярных белков), является то, что в ходе сворачивания их полипептидной цепи не просматривается четких стадий и стабильных интермедиатов. В то же время, в литературе существуют данные в пользу того, что процессы разворачивания/сворачивания мембранных белков проходят через промежуточное состояние, во многом похожее на расплавленную глобулу водорастворимых глобулярных белков. Именно это обстоятельство позволило нам использовать терминологию, применяемую при описании  конформационых превращений  водорастворимых белков, для характеристики конформационных состояний иерсинина, прежде всего для характеристики интермедиата иерсинина при рН 3,0.

Анализ  окружения остатков Trp и Tyr иерсинина с привлечением компьютерной модели пространственной структуры белка. Согласно компьютерной модели пространственной структуры иерсинина, (раздел 2), остатки Trp56 и Trp211 локализованы в -барреле: Trp56 расположен в области контакта мономеров, а остатки Trp211 - на внешней поверхности тримера белка. Оба остатка  находятся в гидрофобном окружении, причем Trp56 – в более гидрофобном. Это было показано ранее при сравнительном исследовании полярности окружения остатков триптофана, входящих в состав Omp F порина из E. coli, выполненного с использованием мутантных штаммов данного микроорганизма, у которых остатки триптофана были частично или полностью заменены на Phe. Анализ контактов остатков триптофана в тримере иерсинина, проведенный с помощью программы МОЕ, показал, что каждый из остатков Trp56 образует гидрофобные связи с остатком Phe38, а также c остатками Ile60 и Val36 соседнего мономера. Остатки Trp106 находятся в петлях L3, внутри  полости поры,  и потому  более доступны молекулам растворителя (рис. 21А). Таким образом, по степени увеличения гидрофобности микроокружения в тримере порина эти остатки располагаются следующим образом: Trp106 - Trp211 - Trp56.

Количество остатков тирозина в иерсинине (26 остатков) значительно превышает число остатков триптофана. Они расположены в разных частях молекулы белка. Остатки тирозина в положениях 101 и 199 находятся соответственно в петлях L3, L5, а Tyr 237 и Tyr 249 - в петле L6. Боковые цепи остатков тирозина, расположенных в -барреле, находятся либо на поверхности тримера (в положениях 153, 228, 269, 308 и 135, 176, 217, 257), где они, соответственно, формируют две регулярные полосы, либо обращены внутрь поры (в положениях 14, 35, 53, 97, 289, 295, 297, 305), либо локализованы в областях контакта между мономерами (Tyr4, Tyr58, Tyr93, Tyr296, Tyr336). Тирозины, формирующие две регулярные полосы, взаимодействующие с окружающим липидным бислоем, показаны на рис. 21, Б. Как видно из рисунка, остаток Trp211 локализован в цепочке тирозинов вблизи наружных петель достаточно близко к остатку Tyr 228. Поскольку эти остатки расположены в разных -стрэндах, разрыхление структуры порина (изменение растояния между -стрэндами) под действием низких значений рН может привести к изменению спектра суммарной эмиссии белка.

Переход в области рН 4,5–4,0–3,0, как было сказано выше, вызван диссоциацией тримера на мономеры. Следствием мономеризации иерсинина может стать разрыв гидрофобных связей между Trp56 и остатками Ile60 и Val36 соседнего мономера. Результатом этого может быть уменьшение тушения индольных хромофоров и некоторое увеличение полярности окружения Trp56. Данное предположение подтверждается сравнительной оценкой доступности остатков триптофана в тримере и мономере иерсинина с помощью программы SPDBV и соответствующими

расчетами, выполненными с помощью программы Molmol.

Степень доступности остатков Trp56 и Trp211 при диссоциации тримера иерсинина становится почти одинаковой (35 и 39,5% соответственно), а доступность Trp106 не изменяется и составляет около 50%.

При уменьшении значения рН от 3,0 до 2,0 по данным флуоресценции происходит конформационный переход, сопровождающийся резким изменением всех параметров спектра излучения белка при обеих длинах волн возбуждения. Появление в спектре триптофановой флуоресценции иерсинина «плеча» при 345 нм свидетельствует о том, что не все три остатка триптофана находятся в одинаковом окружении. Как уже было сказано выше, Trp56 и Trp211 остаются в более гидрофобном окружении по сравнению с Trp106. Микроокружение последнего остановится еще более полярным, и этот эффект может быть связан с титрованием остатка Asp102, который находится вблизи Trp106, и должен иметь аномально низкое значение рКа в силу его локализации в -спирализованном участке петли L3 и образования солевого мостика с Arg136.

А

Б

  Б

Рис. 21. Компьютерная модель пространственной структуры иерсинина:

локализация остатков триптофана (А) и тирозина (Б).

Конформационный переход в области низких значений рН может быть также обусловлен и титрованием карбоксильной группы C-концевой аминокислоты Phe338. Аномально низкое значение рКа этого остатка, возможно, связано с наличием  солевого мостика между ним и  Ala1 при образовании псевдоциклической структуры. Связь между С- и N-концами полипептидной цепи белка в бактериальных поринах играет важную роль для сохранения стабильности их структуры. В соответствии с этим, разрыв этой связи в иерсинине, может вызвать существенные и необратимые нарушения в структуре молекулы. Действительно, как показали наши исследования, при рН меньше 3,0 иерсинин денатурирует необратимо.

Структурно-функциональные перестройки в молекуле порина под действием кислотности среды (на примере конформационых переходов иерсинина). Методом реконструкции белка в БЛМ из моноолеоилглицерина мы проанализировали изменение функциональной активности иерсинина при изменении величины рН. Реконструкцию белка проводили, добавляя порин с обеих сторон мембраны в водную фазу с заданным значением рН (4,5; 5,0; 5,8; 6,3; 7,5; 8,0). Анализ распределения уровней проводимости БЛМ показал, что размеры пор иерсинина в слабокислой и слабощелочной средах различаются. В интервале значений рН 8,0–6,3 наибольшее количество каналов в мембране имело уровень проводимости 240–160 пСм, а при рН 5,0 наиболее вероятный уровень проводимости был равен 12 пСм (рис. 22). Кроме того, в кислой области значений рН (5,0–4,5) снижалась кооперативность образования пор и наблюдались случаи закрытия каналов. В этих условиях также происходило существенное уменьшение эффективности встраивания порина, даже при увеличении концентрации белка.

Таким образом, при уменьшении значения рН среды наблюдались существенные изменения в функциональных свойствах иерсинина. Самым заметным проявлением этих изменений являлось уменьшение на порядок величины проводимости пор в слабокислой среде (при рН 5,0). Как видно из рис. 22, наиболее резкое изменение активности иерсинина наблюдалось при рН 5,8, в отличие от Omp F и Omp C поринов E. coli, для которых подобное изменение в порообразующих свойствах происходило соответственно при рН 7,2 и 6,5

Обнаруженная нами взаимосвязь между изменениями в структуре и функциональной активностью исследуемого порина согласуется с общепринятым в литературе мнением о том, что функционально активные белки имеют два типа конформационных перестроек. Денатурационный переход, связан, как правило, с глубокими конформационными изменениями в структуре белка, сопровождающимися утратой его функциональной активности. Функциональный переход наблюдается между двумя активными формами белка, степень денатурации которого при этом незначительна. Такой переход служит обычно в качестве эффективного регуляторного механизма.

В случае иерсинина денатурационный переход приводит к диссоциации тримеров на мономеры с последующим частичным разупорядочиванием структуры последних. Этот переход мы наблюдали только в области низких значений рН (4,0–2,0). Примером же функционального перехода в порине может служить резкое уменьшение его активности, обнаруженное нами в достаточно узком интервале значений рН, от 5,8 до 5,0. Эти изменения в порообразующих свойствах иерсинина не связаны со сколько-нибудь значительными перестройками в молекулярной организации белка.

Рис. 22. Влияние величины рН на проводимость БЛМ из 1%-ного моноолеоилглицерина

в н-гептане, индуцируемую иерсинином. Водная фаза: 0.1М NaCl в 10 мМ фосфатно-

цитратном буфере с заданным значением рН. Мембранный потенциал 20 мВ.

(А) - изменение проводимости мембран в присутствии порина (5нг/мл) в водной фазе при рН 8,0 и 5,0; (Б) - гистограммы распределения проводимости пор иесинина при различных значениях рН водной фазы; (В) - наиболее вероятная проводимость порина в зависимости от величины рН среды.

5. Влияние липидного матрикса НМ на структуру и функциональную активность порина из Y. pseudotuberculosis

Роль ЛПС в стабилизации структуры и проявлении функциональной активности порина. Известно, что сборка порина и присоединение ЛПС сопровождаются изменением конформации белка. Нами были исследованы изменения конформации иерсинина и его функциональной активности, происходящие в результате отделения связанного с ним ЛПС. С помощью оптической спектроскопии охарактеризована пространственная организация ЛПС-содержащего порина (Пор-ЛПС) и порина, очищенного от ЛПС (Пор). Методом реконструкции в БЛМ проведено сравнительное изучение порообразующей активности этих образцов белка.

       Очистка белка от связанного ЛПС, достигнутая при обработке иерсинина 30%-ным раствором SDS, приводила к значительным изменениям в пространственной организации тримера порина (рис. 23). На уровне третичной структуры белка наблюдалось уменьшение передачи энергии возбуждения флуоресценции от тирозина к триптофану и увеличение доли остатков триптофана, экранированных от поверхности белковой глобулы. Как показали расчеты по спектрам КД, удаление ЛПС приводило к уменьшению суммарной доли β-структуры. Очищенный от ЛПС порин (Пор) представлял собой полностью β-структурированный белок, отличающийся от Пор-ЛПС большей конформационной нестабильностью и склонностью к агрегации. Примечательно, что, несмотря на жесткость обработки, не происходит полного «разворачивания» полипептидной цепи порина с образованием статистического клубка. Напротив, денатурированный белок имеет высокоорганизованную β-структуру. Можно предположить, что образование этой структуры происходит через ассоциацию молекул, которая сопровождается трансформацией неупорядоченной вторичной структуры в β-структуру и образованием межмолекулярных β-связей. Поскольку «выраженность» гидрофобных участков на поверхности белка в процессе денатурации увеличивается (по данным УФ-спектроскпии происходит увеличение светорассеяния растворов иерсинина), можно предположить, что самоассоциацию белка инициируют гидрофобные взаимодействия.

Для выяснения роли ЛПС в проявлении порином функциональной активности мы провели сравнительное изучение порообразующих свойств 3-х образцов белка: Пор-ЛПС, Пор и комплекса (Пор+ЛПС), полученного при молярном соотношении белок/ЛПС 1:200 (рис.24). Анализ флуктуаций тока показал, что исследуемые образцы различаются по эффективности и характеру функционирования в БЛМ. Активность Пор-ЛПС достаточно высока: реконструкция его происходила при концентрациях белка порядка 10-100 нг/мл. Наиболее вероятная проводимость пор составляла 140±20, 240±20 и 480±20 пСм.

Рис. 23. Пространственная структура 

образцов порина до и после очистки

от связанного ЛПС.

Пор-ЛПС  в 0,25% SDS

в 0,1% SDS

Пор в 0,25% SDS

в 0,25% ОГ

  Пор/ЛПС (1:30, моль/моль)

  в 0,25% SDS

Удаление ЛПС приводило к увеличению действующей концентрации на два порядка: до 2 мкг/мл. Характер распределения пор по размерам указывал на увеличение кооперативности их работы, что согласуется с данными УФ-спектроскопии об агрегации белка. Образование комплекса Пор с ЛПС не влияло на величину действующей концентрации белка. Но в отличие от образца Пор, реконструкция комплекса (Пор+ЛПС) в БЛМ вызывала образование пор преимущественно малого диаметра. При этом почти не наблюдалось флуктуаций тока, характерных для кооперативно работающих пор, которые свойственны агрегированному состоянию белка в образце Пор.

       

Рис.24. Гистограммы уровней проводимости каналов, индуцируемых в БЛМ образцами иерсинина с различным содержанием ЛПС:

а – Пор-ЛПС, 0,1 мкг/мл; б – Пор, 2 мкг/мл; в – Пор/ЛПС, 2 мкг/мл; г – Пор/ОГ, 0,01 мкг/мл.

Ранее нами было показано, что в присутствии ОГ структура тримера иерсинина максимально приближена к таковой в НМ бактерий (раздел 1). В связи с этим была проверена порообразующая активность образца Пор после экспозиции в 2% растворе ОГ. Оказалось, что белок Пор в присутствии ОГ проявляет порообразующую активность, сравнимую с активностью Пор-ЛПС. Встраивание порина в модельную мембрану наблюдалось при концентрации белка порядка 10 нг/мл. Наиболее вероятные поры образца (Пор+ОГ) находились в том же интервале проводимостей, что и для исходного Пор-ЛПС. Расчет содержания элементов вторичной структуры свидетельствовал о том, что замена SDS на ОГ приводит к восстановлению некоторой доли неупорядоченной структуры, присущей нативному тримеру, возможно, за счет потери части межмолекулярной β-структуры.

Таким образом можно говорить о ренатурирующем действии ОГ. Как известно, спектроскопия КД дает усредненные данные о содержании той или иной канонической вторичной структуры в белке и не может выявить конформационную гетерогенность образца. Недавно было показано, что многие частично денатурированные белки не имеют стабильной конформации и существуют в двух или более конформационных состояниях, переходящих друг в друга. Можно предположить, что белок Пор в ОГ гетерогенен, при этом в образце имеются конформеры с содержанием неупорядоченной структуры более 5%, в том числе достаточно близкие по вторичной структуре к Пор-ЛПС.. Возможно, в присутствии БЛМ равновесие сдвигается в сторону этих изомеров (поскольку они могут лучше встраиваться в бислой). В таком случае понятно восстановление активности образца Пор до уровня активности исходного белка Пор-ЛПС. В пользу этого свидетельствует и тот факт, что вторичная структура исходного белка Пор-ЛПС в определенных условиях, например в 0.1% SDS, может приближаться к таковой образца Пор в ОГ.

       Проведенные эксперименты продемонстрировали, что существуют определенные требования к конформации порина, например, наличие неупорядоченных участков в полипептидной цепи белка. При этом, если in vivo роль “промотора” в процессе “обретения” белком этой функционально-активной конформации выполняет ЛПС, то в опытах in vitro ЛПС может быть с успехом заменен неионным детергентом, например ОГ.

Влияние условий культивирования на структуру и порообразующие свойства иерсинина. Исследования, проведенные в нашей лаборатории, показали, что качественный состав фосфолипидов и жирных кислот бактерий псевдотуберкулеза мало зависит от способа культивирования бактерий. Однако количество свободных липидов и относительное содержание ФЛ и НЛ в липидных экстрактах Y. pseudotuberculosis варьировали в зависимости от возраста культуры и способа выращивания (на питательном бульоне – ПБ и питательном агаре – ПА). Содержание ФЛ и характер его изменения по мере старения клеток у суспензионных (ПБ) и колониальных (ПА) культур имели различные тенденции. Бактерии в стационарной фазе (СФ), растущие на ПА, содержали заметно большее количество ФЛ, чем клетки, растущие на ПБ (2,6 и 1,7% соответственно). Особенно ярко эта тенденция проявилась в изменении содержания ЛФЭ. Так, у прикрепленных бактерий в фазе линейного роста и в ранней стационарной фазе в клетках наблюдался аномально высокий уровень ЛФЭ (35,9 и 18,2% соответственно) по сравнению со свободно живущими иерсиниями (6,1 и 5,5% соответственно). В рамках проведенного исследования мы сравнили пространственную организацию и функциональную активность поринов в зависимости от температуры выращивания (при 4С, «холодовой» вариант – Х; при 37оС «тепловой» вариант - Т); от среды культивирования (в виде колониальной -ПА и суспензионной -ПБ культур) и в зависимости от возраста культуры (стационарная - СФ и логарифмическая - ЛФ фазы роста). Как показали предварительные исследования, в случае теплового варианта псевдотуберкулезного микроба плотность среды культивирования не имела решающего значения

Таблица 14. Характеристика фосфолипидного состава НМ псевдотуберкулезного микроба, из которых выделены исследуемые образцы порина.

Образец порина

Содержание фосфолипидов, %

  ЛФЭ  ФЭ/ФГ+ДФГ 

(1)Х-ЛФ-ПА

  8,4  1,6

(2)Х-СФ-ПА

  35,9  4,3

(3)Х-СФ-ПБ

  5,5  1,9

(4)Т-СФ-ПА/ПБ

не определяли

.

По данным SDS,ПААГ-электрофореза порины, выделенные по методу Нюрминен из микробной массы, культивируемой в различных условиях (образцы 1-4), находились в олигомерной форме и имели М в области 105-120 кДа. Сравнительное изучение их пространственной структуры было проведено с помощью оптических методов.

       

       

Рис. 25. Спектры КД исследованных образцов поринов при 25С в ближней УФ-области; a – образцы 1 и 2; б – образцы 3 и 4

Спектры КД образцов поринов «холодового» варианта (1, 2 и 3) в ближней УФ-области (240-320 нм) имели полосы положительного знака: при 290 нм, относящуюся к Trp, при 280 и 268 нм, относящиеся к Tyr и/или Phe (рис.25 а и б). Спектр КД порина 2 по сравнению со спектрами других образцов белка в указанной области имел более тонкую структуру (рис. 25а). Это свидетельствует об асимметричном окружении боковых групп выше названных ароматических аминокислот, об их жесткой фиксации, и, как следствие, о высокоорганизованной третичной структуре этого белка. Спектр КД порина из «теплового» варианта указывал на отсутствие выраженной третичной структуры у порина 4.

Таблица 15. Характеристика пространственной структуры и термостабильности образцов порина, полученных из бактерий, культивируемых в различных условиях.

Образец порина

Tyr

Классы триптофана

Температура термоперехода,С

S-форма

I форма

II форма

III форма

(1) Х-ЛФ-ПА

0,19

0,22

0,48

0

0,11

69*  72**

(2) Х-СФ-ПА

0,23

0,26

0,39

0

0,12

74# 71*  75**

(3) Х-СФ-ПБ

0,13

0,14

0,40

0

0,33

76# 75*  77**

(4) Т-СФ-ПА/ПБ

0,25

0,04

0,22

0

0,49

70# 62*  68**

Примечание: # –  определено по данным сканирующей микрокалориметрии;

* –  определено по данным собственной белковой флуоресценции;

** – определено по данным КД

       

Расчет содержания элементов вторичной структуры поринов по данным спектров КД в дальней УФ-области, выполненный по методу Провенчера и Глокера показал, что содержание регулярной β-структуры в образце 2 несколько выше, чем в остальных образцах порина, а порин 4, имел в полипептидной цепи в 2,5 раза больше β-изгибов по сравнению с образцами 1, 2 и 3, что, согласно литературным данным, может служить свидетельством большей нестабильности молекулы белка. Так, в случае белков-прионов образованию их фибриллярной нейротоксической формы предшествует появление конформации, обогащенной β-изгибами.

Содержание и соотношение вкладов остатков триптофана двух классов (S и III) у белков, выделенных из «холодового» варианта колониальной культуры клеток на ЛФ и СФ (образцы 1 и 2), очень близки. Отличались эти белки только по вкладу остатков триптофана класса I. Спектр порина (образец 3), выделенного из «холодового» варианта суспензионной культуры, отличался от спектров образцов 1 и 2 уменьшением вклада тирозина, а также увеличением вклада остатков триптофана формы III, очевидно, за счет уменьшения содержания S-формы этого флуорофора (табл. 15). Можно предположить, что даже изменение только одного из параметров способа выращивания, а именно среды культивирования, приводит к изменению как микроокружения остатков триптофана, так и взаиморасположения остатков тирозина и триптофана в структуре белка. Наибольший вклад в спектр порина, выделенного из клеток «теплового» варианта псевдотуберкулезного микроба (образец 4), обусловлен излучением остатков триптофана класса III, соответствующим эмиссии свободного триптофана. Наименьший вклад в спектр флуоресценции этого образца белка вносят остатки триптофана S-формы и формы I, эмиссия которых определяется расположением внутри молекулы белка и гидрофобным микроокружением, экранирующим флуорофоры от растворителя.

       Таким образом, пространственная организация молекулы порина на уровне третичной структуры оказалась чувствительна к изменению условий культивирования, которые, как было сказано выше, вносят определенные изменения в липидный состав и, соответственно, в строение и свойства НМ бактерий.

На следующем этапе исследования с помощью методов оптической спектроскопии и сканирующей микрокалориметрии мы определили точки термоперехода у исследованных образцов порина и проанализировали изменения в пространственной организации молекулы белка на уровне третичной и вторичной структуры (рис. 26). Характер изменений вторичной структуры поринов 2 (рис. 26а), а также 1 и 4 (рис. 26б) в процессе нагревания был подобен. Тем не менее, качественный анализ спектров КД образцов белка при 85С позволил говорить о различиях в степени этих изменений.

Точки конформационных переходов на уровне вторичной структуры были определены из графика зависимости эллиптичности при 222 нм от температуры. Как известно, эта величина является мерой упорядоченности вторичной структуры белка. Для образцов 1-4 термопереход происходил соответственно при 72, 75, 77 и 68С (табл. 15).

Рис. 26. Спектры КД исследованных образцов поринов; a – образец 2; б – образец 4.

Кривые 1–3 – при 25, 70 и 85С соответственно.

Как видно из рис. 26а, спектры тепловой денатурации вторичной структуры порина 2, проходили через изодихроичную точку при 211 нм, тогда как таковая отсутствует в спектрах КД растворов других образцов белка. На рис. 26, б в качестве примера приведена тепловая денатурация порина 4. Наличие изодихроичной точки в спектрах белка означает, что его конформационный переход из нативного состояния в денатурированное проходит как двухстадийный кооперативный процесс. Отсутствие ее в спектрах КД поринов 1, 3 и 4 указывает на то, что в этом случае в растворе белка, кроме основных форм, присутствуют интермедиаты порина.

С помощью метода сканирующей микрокалориметрии были определены точки плавления образцов порина 2, 3 и 4 (рис. 27). Анализ полученных термограмм позволил сделать следующие выводы. Изменение среды культивирования практически не влияло на термостабильность белка, максимум кривых плавления образцов 2 и 3 приходился на 74  и 76С соответственно (таблица 2). В то же время, увеличение температуры выращивания бактерий псевдотуберкулеза снижает температуру термоперехода белка на 5-6С (табл. 13) и, кроме того, почти в 2 раза увеличивается температурный диапазон плавления порина. Для образцов 2 и 3 он лежит между 72 и 80С  и протяженность его составляет 8С, а порин из «теплового» варианта бактерий плавится в диапазоне 60-75С  и соответственно протяженность его равна 15 С (рис.27).

Рис. 27. Температурная зависимость избыточного удельного теплопоглощения образцов порина в трис-HCl буфере (10-2 М, рН 7,6), выделенных из культур Y. pseudotuberculosis, выращенных при различных условиях: 1 – «холодовой» вариант колониальной культуры (образец 2), 2 – «холодовой» вариант суспензионной культуры (образец 3), 3 – «тепловой» вариант суспензионной культуры (образец 4). Вертикальная полоса: 1000 Дж / кг х град.

На рис. 28 приведена зависимость квантового выхода флуоресценции исследованных образцов порина от температуры. Как видно из рисунка, температуры термопереходов белков, определяемые по приведенным кривым, несколько ниже соответствующих значений, полученных из данных микрокалориметрии и спектров КД (табл. 15). На основании этого можно предположить, что тотальному плавлению молекулы белка (фиксируемому методом микрокалориметрии) и изменениям на уровне вторичной структуры порина предшествуют изменения в отдельных доменах молекулы белка, которые приводят к изменению взаиморасположения ароматических флуорофоров и, соответственно, интенсивности флуоресценции. Как можно видеть, S-образный участок на кривых зависимости квантового выхода флуоресценции исследованных поринов от температуры как раз «заканчивается» при температуре, соответствующей точке плавления белка (рис. 28). Следует заметить, что в случае образца 2 этот участок на кривой анализируемой зависимости наиболее выражен, что свидетельствует о высокой степени кооперативности термоперехода.

Рис. 28. Зависимость квантового выхода флуоресценции исследуемых образцов порина от температуры.

Порообразующие свойства исследованных образцов иерсинина в составе ПГБК. Реконструкция в липидный бислой этого фрагмента бактериальной мембраны является разработанным нами подходом при изучении поринов с помощью техники БЛМ. Преимущество такого подхода состоит в том, что порин в комплексе с ПГ сохраняет важное окружение и связи, имеющиеся в нативной мембране. ПГБК, в состав которых входили образцы порина 1-3 из «холодовых» вариантов Y. pseudotuberculosis, были высокоактивны. Наибольшая частота встраивания наблюдалась для ПГБК, в состав которого входил образец 2.

В случае образца 4, полученного из «теплового» варианта микроорганизма, при реконструкции в БЛМ характерные включения наблюдались лишь при увеличении концентрации комплекса до максимального значения в исследованном диапазоне концентраций (0,01 – 1,5 мкг/мл). Полученные данные свидетельствуют о значительном снижении функциональной активности поринов при увеличении температуры выращивания микроорганизмов. Возможно, неактивные в БЛМ комплексы содержат порины в конформации, соответствующей «закрытому» состоянию (конфигурации) поры.

Рис. 29. Гистограммы уровней проводимости пор, образованных исследованными образцами порина в составе ПГБК при мембранном потенциале 20 мВ (черные колонки)

и 50 мВ (белые колонки), ширина колонок – 24 пСм. N – количество каналов:

а– образец 3 в составе ПГБК;

б – образец 4 в составе ПГБК;

в – образец 2 в составе ПГБК.

       Как показал анализ флуктуаций тока через БЛМ (рис. 29), для активных ПГБК из "холодовых" вариантов псевдотуберкулезного микроба наиболее вероятный уровень проводимости пор соответствовал значению 240-300 пСм, а для комплексов из "тепловых" вариантов – 120 пСм. В порядке уменьшения величины наиболее вероятной проводимости, индуцируемой в БЛМ, исследованные образцы ПБГК можно расположить следующим образом: Х/СФ/ПА (2) Х/СФ/ПБ (3) Х/ЛФ/ПА (1) Т/СФ/ПБ/ПА (4).

Обнаруженная нами корреляция между повышенным содержанием ЛФЭ в клетках «холодового» варианта колониальной культуры Y. pseudotuberculosis и особенностями пространственной структуры выделенного из них порина, заслуживает особого внимания. Белок  из клеток, выращенных в условиях, максимально соответствующих природным, отличается наиболее компактной пространственной структурой и наибольшей порообразующей активностью. В свою очередь, ЛФЭ, как известно, являясь молекулярным шапероном интегральных мембранных белков, защищает их от термического шока, препятствует агрегации и способствует образованию функционально активной формы белка. В связи с этим, высокое содержание ЛФЭ у бактерий иерсиний при сапрофитном способе существования может представлять собой своеобразный «инструмент», способствующий поддержанию стабильной конформации поринов и, соответственно, увеличению адаптационных возможностей микроорганизма.

       

6. Получение и характеристика рекомбинантного порина

из Y. pseudotuberculosis

       Порин НМ Y. pseudotuberculosis был экспрессирован путем трансформации кодирующей последовательности гена этого белка в клетках E. coli. Кодирующая последовательность ompF гена была получена методом ПЦР при использовании типоспецифических праймеров к хромосомной ДНК, выделенной из микробной массы Y. pseudotuberculosis. Повышенный уровень экспрессии целевого белка был достигнут путем размещения гена после сильного промотора, индуцируемого IPTG. По данным иммуноблота (рис. 30) в лизате трансформированных клеток E.coli  штамма BL21 (DE3) обнаружен белок, имеющий подвижность в области 40 кДа, который взаимодействовал со специфическими антителами к термостабильному мономеру порина Y. pseudotuberculosis. В то же время, в лизате клеток, не подвергшихся трансформации, подобный белок не был выявлен. На основании этих данных был сделан вывод, что обнаруженный белок соответствует порину из Y. pseudotuberculosis.

Тельца включения (ТВ) выделяли из микробной массы центрифугированием в присутствии ферментов (лизоцим, ДНК-аза), ингибитора протеаз и детергентов (ЭДТА, ДОХ). Осадок ТВ экстрагировали 8 М мочевиной при озвучивании с частотой 44 мГц. Концентрацию белка определяли спектрофотометрически (при 280 нм), она составила 26 мг/мл. Согласно данным SDS,ПААГ-электрофореза (рис.30а) и иммуноблота (рис.30б), полученные ТВ содержали белок, по М соответствующий полипептиду 40 кДа (денатурированному мономеру порина из Y. pseudotuberculosis).

Рис. 30. (а) Иммуноблоттинг белковых фракций с кроличьими антисыворотками, полученными при иммунизации ТСБ мономером: 1 – лизат  нетрансформир­ованных клеток E. coli; 2 – лизат трансформированных клеток E. coli.

(б) Электрофорез белковых фракций:

1 - маркеры,

2 – РБ-2,

3 – РБ-2 (прогретый при 100С),

4 – ТСБ мономер иерсинина,

5 – РБ-1, 6 – ТВ в 8М мочевине,

7 – ТВ в 8М мочевине (прогретые при 100С).

Учитывая устойчивость порина Y. pseudotuberculosis к действию SDS, для рефолдинга рекомбинантного порина использовали гель-хроматографию на Сефакриле S-300 в присутствии SDS. Как видно из рис.30б, очищенный от мочевины белок являлся мономером порина (РБ-1). Окраска ионами серебра не выявила присутствия ЛПС в образце РБ-1. Для получения порина в олигомерной форме использовали ионообменную хроматографию и неионный детергент Zw 3-14, который, согласно литературным данным, дает хорошие результаты при сборке рекомбинантных мембранных белков in vitro. Последовательная хроматография на DЕАЕ-сефарозе CL 6B и СМ-сефарозе CL 4B в присутствии Zw 3-14 позволила получить рекомбинантный белок (РБ-2), совпадающий по подвижности в условиях SDS,ПААГ-электрофореза с тримерной формой порина (рис. 30б).

Пространственная структура рекомбинантных белков была охарактеризована с помощью методов оптической спектроскопии. Как следует из спектров КД в пептидной области, РБ-1 имел регулярную вторичную структуру, подобную структуре изолированного мономера порина. Спектры КД в пептидной области рекомбинантного тримера РБ-2 были подобны спектру, полученному для изолированого порина из псевдотуберкулезного микроба в растворе ОГ. Расчеты элементов вторичной структуры по спектрам КД с использованием программы  CONIN/LL (пакет программ CDPro) приведены в табл. 16.

Как следует из данных табл. 16, содержание  -спирали в структуре РБ-1 больше, чем у рекомбинантного тримера, но меньше, чем у ТСБ формы изолированного мономера. Известно, что в процессе выделения порина из НМ бактерий небольшая часть тримеров диссоциирует на мономеры, но это не приводит к нарушениям регулярной структуры белка, Только совместное воздействие температуры и детергента приводит к появлению в молекуле порина дополнительных участков -структуры за счет уменьшения количества - и неупорядоченной структуры.

Таблица 16. Соотношение элементов вторичной структуры рекомбинантных и изолированных поринов с использованием программы CONTIN/LL (пакет программ CDPrо)

Образец

-структура

-структура

-изгиб

Неупоря­

доченная

структура

Кол-во реперных белков

Тип белка*

РБ -1

0,057#

0,31

0,230

0,401

43

все

ТСБ

0,157

0,297

0,226

0,320

43

все , +

РБ - 2

0,038

0,402

0,218

0,341

43

все

ТЛБ

0,043

0,421

0,219

0,318

48

все , /

  • Примечание: Программы, входящие в пакет программ CDPro.

#        Значения, соответствующие содержанию элементов вторичной структуры белка, приведены в единичных долях.

Эти наблюдения дают возможность предположить, что пространственная организация РБ-1 ближе к структуре мономера, полученного при солюбилизации порина из НМ бактерий. Большая электрофоретическая подвижность РБ-1 по сравнению с таковой нативного мономера объясняется тем, что рекомбинантый мономер не содержит ЛПС, который, как известно, приводит к уменьшению подвижности образца в условиях SDS,ПААГ-электрофореза. Таким образом, полученные рекомбинантные белки достаточно близки к изолированным поринам по содержанию элементов вторичной структуры, небольшие различия отмечаются только в количестве  неупорядоченной структуры.

Анализ спектров КД образцов РБ-1 и РБ-2 в ароматической области УФ спектра позволяет говорить о недостаточно сформированной, более «рыхлой», третичной структуре интермедиатов рефолдинга порина по сравнению со структурой изолированных белков. Так, спектр КД образца РБ-2 не имел четко разрешенных положительных полос, свидетельствующих о жестко фиксированной третичной структуре белка, а спектр КД РБ-1 был подобен спектру полностью -структурированного мономера порина, структура которого была восстановлена при добавлении эндогенного ЛПС (раздел 5). Подобные спектры характерны для частично свернутых интермедиатов фолдинга мультидоменных белков, так называемых «misfolded proteins».

Исследования структуры РБ-1 и РБ-2 методом собственной белковой флуоресценции подтвердили данные КД, однако различия в пространственной структуре изолированных и рекомбинантных поринов в случае мономера оказались более выраженными. Для спектра РБ-1 было характерно значительное увеличение вклада остатков тирозина в суммарную флуоресценцию белка. В спектрах триптофановой флуоресценции обоих рекомбинантных белков был отмечен значительный сдвиг максимумов в длинноволновую область спектра и существенное уменьшение интенсивности излучения этого флуорофора, что характерно для белков, у которых остатки триптофана находятся на поверхности молекулы белка и не экранированы от растворителя белковой матрицей.

Рис. 31. Запись тока в БЛМ, индуцируемого тримером иерсинина (а) и РБ-2 (б). Концентрация образцов белка 50 нг/мл.

Порообразующая активность рекомбинантных поринов РБ-1 и РБ-2 была изучена методом реконструкции в БЛМ. При введении в водную фазу РБ-2 в концентрации 50 нг/мл в БЛМ наблюдались долгоживущие дискретные флуктуации тока поринового типа (рис.31б). Наиболее вероятная проводимость пор, образованных РБ-2, составляла 240±40 пСм, что сравнимо с проводимостью каналов изолированного тримера порина псевдотуберкулезного микроба (рис.31а). Однако в случае РБ-2 наблюдалась меньшая частота включения белка в модельную мембрану и менее эффективный рост интегральной проводимости БЛМ. В случае РБ-1 наблюдалось только включение единичных пор, что можно объяснить либо присутствием незначительного количества олигомерной формы порина, либо способностью мономера образовывать в присутствии липидного бислоя активные тримеры.

Рис. 32. Иммуноферментный анализ взаи-модействия сывороток кроликов, иммунизи-рованных ТСБ мономером (а) и тримером (б) иерсинина с гомологичными антигенами и образцами рекомбинантного белка.

Антигенная структура рекомбинантных белков была охарактеризована с помощью ИФА. Результаты реакции (рис.32) свидетельствуют о том, что структура антигенных детерминант РБ-1 и РБ-2 лишь частично соответствует структуре аналогичных детерминант изолированных мономера и тримера иерсинина. Общими, скорее всего, являются так называемые «линейные» антигенные детерминанты, формирующиеся на уровне первичной и/или вторичной структуры порина (см. ниже в разделе 7). В то же время «составные», или «прерывистые» антигенные детерминанты, образующиеся за счет участков последовательности белка, сближенных в процессе формирования его пространственной структуры, очевидно, не совпадают с таковыми для изолированных форм порина. Этот вывод подтверждается данными исследования структуры рекомбинантных белков, приведенными выше.


7. Антигенная структура иерсинина

Идентификация линейных и конформационных антигенных детерминант иерсинина. Изменения антигенной структуры порина, связанные с изменением условий его выделения. Сравнительный анализ антигенной структуры 3-х изолированных молекулярных форм иерсинина, полученных при солюбилизации НМ, был проведен с помощью ИФА. В качестве антигена сравнения был взят ПГБК, в составе которого тример порина, как было сказано выше, находится в конформации, близкой к нативной.

Рис. 33. Ингибирование реакции связывания ПГБК с поликлональной кроличьей антисывороткой к тримеру иерсинина. Ингибиторы: тример (1), мономер (2) и денатурированный мономер (3) иерсинина; по оси Х – концентрация белка, 10-11 М.

Рис. 39. Иммуноферментный анализ: а, б – ингибирование реакции связывания комплекса ПГ-белок с антисывороткой к поверхностным белкам Y. pseudotu-berculosis комплексом ПГ-белок (1), образцами тримера иерсинина в присутствии 0,1% SDS (2, 5), 0,2% додецил­мальтозида (3, 6), 0,2% октилглюкозида (4,7), взятыми непосредственно (2-4) или после нагревания в соответствующем детергенте при 90оС в течение 10 мин (5-7).

Рис. 34. Ингибирование реакции связывания Пор-Lys (а) и Пор-SDS (б) с гомологичными антисыворотками. Ингибиторы: Пор-SDS (1); Пор-Lys (2) и денатурированный мономер иерсинина (3).



Тримерная форма порина имеет два типа антигенных детерминант: непрерывные (линейные) и прерывистые (составные, или конформационные). Этим объясняется большая степень ингибирования выбранной нами тест-системы тримером порина (рис.33, кривая 1). Конформационные детерминанты формируются на уровне третичной структуры белка и разрушаются при диссоциации тримера белка на мономеры. Поэтому у мономерных форм порина обнаружены только линейные детерминанты, которые определяются АК последовательностью и вторичной структурой белка и сохраняются при термоденатурации порина (рис. 33, кривые 2 и 3).

Сравнительное исследование серологической активности Пор-SDS и Пор-Lys (рис.34) выявило существенные различия между ними. Гетерологичные антигены ингибируют гомологичные тест-системы (для обоих образцов иерсинина) только на 30-40%. Таким образом, различия в пространственной организации этих белков (раздел 2), обусловленные способом получения поринов, существенно влияют и на антигенную структуру Пор-SDS и Пор-Lys.

Предсказание антигенноактивных участков OmpF-подобного порина Y. pseudotuberculosis, потенциально способных индуцировать протективный иммунный ответ к патогенным иерсиниям. Как было сказано выше (раздел 2), основные отличия между поринами Y. pseudotuberculosis и Y. pestis приходятся на петли L6 и L8, которые, согласно литературным данным, определяют антигенные различия этих белков. Известно, что именно эпитопы поринов, экспонированные на поверхность белка, могут быть использованы в качестве компонентов вакцинных препаратов.

С помощью программы ProPred (MHC>

Таблица 17. Локализация гомологичных пептидов в пределах вторичной структуры поринов, выявленных с помощью теоретических рсчетов.

OmpF

β-тяжи (%)

L-петли (%)

β + L участки (%)

Y. pseudotuberculosis

63

13

24,0

Y. pestis

71

8.5

20.5

Y. enterocolitica

74

8

8,0

OmpC

Y. pseudotuberculosis

66

10.5

23.5

Y. pestis

66

10.5

23.5

Для всех OmpF поринов патогенных иерсиний выявлены гомологичные пептиды: YGKVDARHS; YVQSKGKD; YVSVGTYYYFNK. Для OmpF и OmpС поринов Y. pestis и Y. pseudotuberculosis полностью совпали три пептида: FNKNMSTYV; YNKDGNKLD; YVDYKINLL. Пептид YNKDGNKLD оказался общим для всех 5-ти проанализированных поринов. Основное количество пептидов, выявленных для OmpF и OmpС поринов, находится в трансмембранных участках молекулы белка.

С помощью программы ADEPT были предсказаны В-клеточные антигенные детерминанты поринов Y. pseudotuberculosis и Y. pestis. Основные предсказанные эпитопы OmpF Y. pseudotuberculosis локализованы в петлях, экспонированных в периплазматическое и внеклеточное пространство. В результате анализа полученных данных были определены максимально доступные для взаимодействия с антителами антигенно-активные участки исследованных поринов, наиболее перспективные для индукции протективного гуморального ответа.

Поскольку в ряде работ была показана важная роль Т-клеточного иммунного ответа для защиты животных от патогенных иерсиний, было решено проанализировать аминокислотные последовательности исследованных OmpF поринов на наличие эпитопов как для CD4+, так и для CD8+ Т-лимфоцитов человека. Анализ проводился с помощью программы PLSpred2, предназначенной для предсказания Т-клеточных антигенных детерминант. Основой предсказательного метода программы являются аддитивные матрицы, полученные в результате анализа с помощью метода частных наименьших квадратов экспериментальных данных, взятых из базы IEDB, содержащей сведения о взаимодействии пептидов с различными аллелями HLA (Human Leukocyte Antigen).

Таблица 18. Локализация и АК последовательность потенциально иммуногенных пептидов поринов Y. pseudotuberculosis и Y. pestis

HLA класса I (35 аллелей)

Фрагмент OmpF

Последовательность

Кол-во аллелей, взаимодействующих с пептидом

HLApred/

HLAall*

313-321

YVDYKINLL

12

26/35

263-271

AQYQFDFGL

9

46-54

FGFKGETQI

7

234-242

VMYAETQNL

6

225-233

YDANNVYLA

4

251-259

RDIEITAQY

4

HLA класса II (50 аллелей)

303-311

YYYFNKNMS

32

46/50

297-305

YVSVGTYYY

22

121-129

FGGDSISNS

Примечания.

Все указанные пептиды обладают широкой МНС-специфичностью.

Все указанные пептиды консервативны у поринов Y. pseudotuberculosis и Y. pestis.

Нумерация фрагментов по последовательности OmpF Y. pseudotuberculosis (Q5EMM5).

*Количество аллелей HLA, взаимодействующих хотя бы с одним из предсказанных эпитопов (HLApred), по отношению к общему количеству аллелей, использованных при предсказании (HLAall).

       

С помощью PLSpred в составе первичной структуры поринов Y. pseudotuberculosis и Y. pestis были идентифицированы Т-клеточные эпитопы для 35 аллелей HLA класса I и 50 аллелей HLA класса II. Особое внимание уделялось консервативным пептидам поринов патогенных иерсиний, обладающим широким спектром специфичности по отношению к различным аллелям HLA. С помощью программы BLAST, с использованием матрицы антигенного сходства аминокислот, предсказанные эпитопы были проанализированы на наличие локальной гомологии с белками человека (использовалась база данных RefSeq из Proteinbank за 10.04.2006, содержащая 34066 записей). Пептиды, имевшие локальное сходство с белками человека больше 88%, были исключены из полученной выборки. Пептидные фрагменты исследованных поринов, наиболее перспективные для индукции Т-клеточного иммунного ответа, приведены в таблице 18.

Таким образом, в рамках проведенного исследования осуществлен выбор антигенно-активных участков OmpF поринов Y. pseudotuberculosis и Y. pestis, перспективных для последующего конструирования перекрестно реактивных полиэпитопных синтетических вакцин. Выявленные идентичные участки удовлетворяют требованиям, предъявляемым к потенциально иммуногенным пептидам, и могут быть использованы для дизайна вакцинных препаратов и разработки диагностических тест-систем нового поколения.

8. Иммунобиологические свойства иерсинина

Антигенное родство поринов рода Yersinia. Как показали наши исследования, обе молекулярные формы иерсинина были иммуногенны для кроликов. По данным ИФА титры полученных антисывороток составляли 1/51200 - 1/102400. ЛПС из бактерий соответствующих сероваров Y. pseudotuberculosis реагировали с антисыворотками на уровне фона, то есть поликлональные специфические сыворотки к порину практически не содержали антител к ЛПС. Антитела к поринам образовывались также при иммунизации животных целыми клетками и фракцией белков НМ.

Рис. 35. Результаты взаимодействия иерсинина с кроличьими антисыворот­ками (АС) к различным бактериям рода Yersinia методом ИФА: 1-6 – АС к 3; 5; 6; 8; 6.30; 6.31 сероварам Y. enterocolitica; 7-10 AC к 16f; 28d; 11.246c; 12.25e сероварам Y. kristensenii; 11 – AC к 17 серовару Y. intermedia; 12 – к 5 серовару Y. frederiksenii; 13 - АС к иерсинину.

Обнаружено, что порины являются видо- и родоспецифическими антигенами. Так, методом ИФА показано, что с помощью порина из Y. pseudotuberculosis выявляются антитела в антисыворотках кроликов, полученных ко всем 6-ти сероварам псевдотуберкулезного микроба. В то же время порин из бактерий Y. pseudotuberculosis реагирует с антисыворотками к бактериям различных сероваров Y. enterocolitica, Y. kristensenii, Y. intermedia и Y. frederiksenii. (рис. 35)

Однако при исследовании взаимодействия иерсинина и порина из Y. enterocolitica с антителами к некоторым микроорганизмам семейств Enterobacteriaceae и Brucellaceae обнаружен значительно более низкий уровень перекрестных реакций (рис. 36).

       

Рис. 36. Результаты взаимодействия поринов из Y. pseudotuberculosis и Y. enterocolitica с кроличьими антисыворотками к бактериям семейств Enterobacteriacae, Brucellaceae с помощью ИФА:

А: взаимодействие порина из Y. enterocolitica с антисывороткой к порину из Y. pseudotuberculosis (1), с антисыворотками к бактериям 1-6 сероваров Y. pseudotuberculosis (2-7) соответственно

Б: взаимодействие иерсинина с антисыворотками к 3,5,8,9,6.30, 6.31 сероварам Y. enterocolitica (1-6) соответственно; с антисыворотками к 16.f, 28d, 11.246c, 1225e сероварам Y.kristensenii (7-10) соответственно; с антисывороткой к 17 серовару Y. intermedia (11); с антисывороткой к 5 серовару Y. frederiksenii (12); с антисывороткой к иерсинину (13);

В: взаимодействие иерсинина с антисыворотками к Shigella dyzenteriae (1); S. sonnei (2); S. flexneri (3); Salmonella ABCDE (4); S. typhimurium (5); S. paratyphi B (6); S. paratyphi A (7); S. anatum (8); S.heidelberg (9); S. enteritidis (10); S. choleraesuis (11); E. coli (12); Brucella sp. (13); 14 – нормальная кроличья сыворотка.

Вывод о родоспецифичности поринов Yersinia подтвержден методом иммуноблоттинга. Кроличьи антисыворотки, полученные к иерсинину, фракции белков НМ псевдотуберкулезного микроба и целым клеткам Y. kristensenii, выявляют гетерологичные порины из других бактерий рода Yersinia (рис 37).

Рис. 37. Иммуноблоттинг сывороток кроликов, иммунизированных (а) мономером иерсинина; (б) фракцией белков НМ Y.pseudotuberculosis; (в) целыми микробными клетками Y.kristensenii.

Электрофореграмма лизатов клеток: 1 - Y. intermedia; 2 - Y. enterocolitica; 3 - Y. kristensenii;

4 - Y. frederiksenii; 5 - Y. pseudotuberculosis. Микроорганизмы выращены при 4-6оС (х); при 37о С (т).

Иммуногенные свойства поринов иерсиний (на примере порина из Y. pseudotuberculosis)

Иммунный ответ к иерсинину у человека и животных. С целью выявления видовых различий формирования гуморального иммунного ответа к иерсинину с помощью иммуноблоттинга были изучены антисыворотки белых беспородных мышей, морских свинок и обезьян, полученные от животных, выживших после перорального введения агаровой культуры возбудителя псевдотуберкулеза (Y. pseudotuberculosis 1В серовара, штамм 680), а также сыворотки людей, переболевших этой инфекцией. Поскольку показано, что развитие псевдотуберкулеза у человекоподобных обезьян является адекватной моделью развития этой инфекции у людей, особое внимание было уделено изучению иммунного ответа к иерсинину у павианов гамадрилов (рис.38).

В качестве контрольных сывороток использовали сыворотки интактных животных, а в качестве контрольных антигенов в иммуноблоттинге, помимо ТСБ мономера иерсинина, использовали лизаты клеток Y.pseudotuberculosis 1В серовара (штамм 680).

Рис. 38. Иммуноблоттинг иммунных сывороток людей (7,8), павианов гамадрилов (5,6), морских свинок (3,4) и мышей (1,2) с иерсинином (нечетные дорожки) и лизатом клеток Y. pseudotuberculosis 1В серовара, штамм 680 (четные дорожки).

У мелких лабораторных животных, перенесших псевдотуберкулез, через 21 сутки  выявлялись специфические антитела к ТСБ мономеру иерсинина. Заражение этих видов животных культурой Y. pseudotuberculosis индуцировало образование специфических антител к ограниченному количеству антигенов псевдотуберкулезного микроба, в том числе к ТСБ мономеру иерсинина. При этом доминирующими по интенсивности на иммуноблотах были зоны, соответствующие антигенам с М больше 60 кДа (у морских свинок) или антигенам с М в области 20 - 14 кДа (у неинбредных мышей).

В сыворотках обезьян, переболевших псевдотуберкулезом, также были обнаружены специфические антитела, которые взаимодействуют с антигенными детерминантами ТСБ мономера иерсинина, причем в случае лизата клеток Y. pseudotuberculosis зона с М 40 кДа преобладала. Это, очевидно, свидетельствует о происходящих при псевдотуберкулезной инфекции иммунных перестройках, которые сопровождаются в организме обезъян выработкой значительного количества антител к линейным детерминантам иерсинина. Подобная закономерность наблюдалась и у людей, переболевших псевдотуберкулезом (для анализа были использованы сыворотки с титром специфических антител в реакции непрямой  гемагглютинации  1:180 - 1:3200). В исследованных сыворотках среди антител к другим поверхностным антигенам НМ бактериальной клетки преобладали специфические антитела к ТСБ мономеру иерсинина.

Различия, обнаруженные в интенсивности гуморального ответа к ТСБ мономеру иерсинина у мелких экспериментальных животных, с одной стороны, и у обезьян павианов гамадрилов и людей, с другой стороны, свидетельствует о том, что у последних этот ответ более выражен.

Динамика иммунного ответа к иерсинину (на мышиной модели). Известно, что “представление” белкового антигена в макроорганизме во многом зависит от способа введения антигена и определяется степенью денатурации белка, которая, в свою очередь, характеризует “выраженность” тех или иных антигенных детерминант.

Динамика развития гуморального ответа на белковые антигены достаточно хорошо изучена. Как правило, изменение количества антител описывается кривой, состоящей из участка логарифмического роста уровня антител, участка их стабильного накопления (плато) и участка, соответствующего постепенному снижению количества специфических иммуноглобулинов. Ответ начинается с синтеза антител класса IgM, а затем происходит переключение на синтез антител класса IgG. В зависимости от природы антигена, дозы, а также состояния иммунной системы организма значительный уровень антител может иногда сохраняться на протяжении недель и даже месяцев после иммунизации.

Исследование динамики индукции иммуноглобулинов у мышей двух линий (CBA и BALB/c) при иммунизации животных тримером и ТСБ мономером иерсинина показало, что у мышей обеих линий наблюдается невысокий уровень антител к иерсинину. Так, максимальное значение оптической плотности в ИФА для специфических сывороток мышей линии СВА составляло 1,0, а у мышей линии ВАLВ\с - 1,2. При этом значение оптической плотности нормальной сыворотки не превышало 0,2.

Зависимость иммунного ответа от дозы обеих молекулярных форм порина характерна для мышей обеих линий, однако при иммунизации тримером иерсинина она выражена в большей степени (рис. 39). В этом случае при увеличении дозы антигена наблюдалось не только увеличение интенсивности иммунного ответа, но и изменение формы кривой антителообразования. При иммунизации мономером увеличение дозы антигена практически не изменяло характер кривой динамики иммунного ответа, но влияло на напряженность и длительность ответа. У мышей линии BALB/c значительный уровень антител наблюдался в течение полутора месяцев после начала иммунизации.

Можно предположить, что наблюдаемая зависимость от дозы и колебательный характер иммунного ответа на порин обусловлены несколькими причинами. Одна из них, очевидно, состоит в том, что различные антигенные детерминанты тримера и мономера белка распознаются независимо, и ответ к ним формируется в разное время. Например, обнаружено, что в процессе формирования иммунного ответа к иерсинину уменьшается количество антител, специфичных к олигомерной форме белка (т.е. к “конформационным“ детерминантам) и возрастает количество антител, специфичных к мономеру (т.е. к “линейным” детерминантам). Aнтитела к тримеру преобладают в первые две недели от начала иммунизации, максимальное их количество приходится на 9 - 10-й день (рис.39д).

Рис. 39. Динамика антителообразования у мышей (а-г) линий СВА (а, в ) и

BALB/c (б, г): а, б - иммунизация тримером иерсинина: 10 мкг (кривая 1), 100 мкг (кривая 2);

в, г - иммунизация ТСБ мономером: 10 мкг (кривая 3), 100 мкг (кривая 4);

(д) - динамика изменения специфичности антител у мышей линии BALB/c:

взаимодействие антисыворотки к тримеру с гомологичным  антигеном (кривая 1);

взаимодействие той же сыворотки с ТСБ мономером (кривая 2);

(е) - динамика индукции класс-специфических иммуноглобулинов у мышей линии

BALB/c при иммунизации ТСБ мономером: однократная иммунизация,

100 мкг (кривая 1); двукратная иммунизация, 100 мкг (кривая 2).

Время второй иммунизации - 9-й день.

В эксперименте на мышах линии BALB/c было установлено, что на ранних стадиях иммунного ответа (до 12-го дня) у мышей вырабатываются иммуноглобулины класса M, а затем происходит переключение на индукцию иммуноглобулинов класса G (рис.39е). При этом повторное введение антигена не вызывает образования у животных IgМ антител. Следует отметить, что заметное увеличение уровня антител наблюдается на 3-й - 4-ой неделе после начала иммунизации только в случае введения антигена в ТСБ форме.

       Как известно, появление антител в результате иммунизации белковыми антигенами может стимулировать синтез антиидиотипов, которые, в свою очередь, стимулируют синтез антител к антигену. Наблюдается автоколебательный процесс, где каждая новая волна определяется подключением новых генераций клеток, при этом меняется изотип антител как от IgM к IgG, так и в пределах IgG класса.

В связи с этим, окончательная форма кривой иммунного ответа к иерсинину является результатом наложения независимых ответов на разные антигенные детерминанты, переключением изотипов антител, а также идиотип- антиидиотипической регуляции. Скорее всего, переключение изотипов иммуноглобулинов G после 12-го дня от начала иммунизации является определяющим в формировании колебаний уровня антител к иерсинину.

Для выявления различий в иммуногенной активности нативной (тримерной) и денатурированной (мономерной) форм иерсинина у людей в процессе развития инфекции сравнивали сыворотки больных псевдотуберкулезом на первой и третьей неделях заболевания. Иммуноблоттинг изолированных молекулярных форм иерсинина с пуловой сывороткой и индивидуальными сыворотками больных людей выявил наличие специфических антител к нативной тримерной и денатурированной мономерной формам белка на первой неделе заболевания. В то же время в более поздние сроки заболевания (через три недели), в сыворотках больных выявлялись  антитела только к ТСБ мономеру иерсинина

Таким образом, на ранних стадиях заболевания псевдотуберкулезом в макроорганизме вырабатываются специфические антитела к обоим типам антигенных детерминант иерсинина, что способствует формированию полноценного антительного ответа к этому белку НМ Y. pseudotuberculosis. Однако значительно большая длительность и напряженность иммунного ответа к термоденатурированному мономеру порина по сравнению с тримером позволяют рассматривать его в качестве наиболее перспективной для разработки и создания вакцинных препаратов.

Протективная активность иерсинина  продемонстрирована в тесте активной защиты мышей (линии СВА) и морских свинок. Исследования показали, что при заражении двукратно иммунизированных мышей бактериями 1 серовара Y. pseudotuberculosis (в дозе 10 - 30  LD50) защитная доза (ED50 ) порина оказалась равной в среднем 0,13 мкг, а при заражении такой же дозой бактерий 3 серовара Y. pseudotuberculosis - среднее значение ED50 составило 6,3 мкг. Летальная доза (LD50) при заражении мышей бактериями псевдотуберкулеза 1 серовара, предварительно иммунизированных двукратно порином (10-100 мкг), превышала LD50  неиммунных мышей примерно в 100-1000 раз. Тример иерсинина по сравнению с ТСБ мономером белка оказался менее эффективным при защите от экспериментальной псевдотуберкулезной инфекции у мышей и морских свинок.

Другие биологические свойства иерсинина. Известно, что значительную роль в иммунном ответе макроорганизма на псевдотуберкулез играют клетки системы мононуклеарных и полинуклеарных фагоцитов, в частности макрофаги. В связи с этим, было исследовано взаимодействие бактерий псевдотуберкулеза с перитонеальными макрофагами мышей, иммунизированных иерсинином. Установлено, что иммунизация животных порином увеличивает фагоцитарный показатель (ФП) - количество макрофагов, участвующих в фагоцитозе. Усиливалась также поглотительная и переваривающая активность макрофагов. ФП клеток иммунизированных мышей увеличивался в среднем на 10% по сравнению с клетками контрольных животных, а фагоцитарное число (ФЧ), т.е. число бактерий, обнаруженных на одном макрофаге у иммунизированных мышей, увеличивалось в 2-3 раза по сравнению с ФЧ контрольных животных

Изучено влияние тримерной и мономерной форм порина на адгезию и инвазию псевдотуберкулезного микроба в эпителиальные клетки Rh929. Предварительная обработка культуры клеток тримером иерсинина приводила к проникновению на два порядка большего числа бактерий псевдотуберкулеза, нежели соответствующая обработка мономерной формой белка. Полученные данные позволяют рассматривать нативную (олигомерную) форму иерсинина как один из факторов вирулентности псевдотуберкулезного микроба.

В настоящее время вирулентность иерсиний связывают с наличием так называемой плазмиды вирулентности, кодирующей ряд термостабильных белков с молекулярной массой 120-240 кДа. Установлено, что из трех слагаемых вирулентности (способности к адгезии и инвазии, способности к внутриклеточному размножению и цитотоксического действия на клетки животных тканей) только два обусловлены присутствием плазмиды вирулентности. Первый этап инфекции - прикрепление и проникновение возбудителя - не зависит от плазмиды, и пока нет прямых экспериментальных доказательств участия в этом процессе упомянутых выше высокомолекулярных полипептидов, кодируемых плазмидой. В связи с этим полученные нами результаты позволяют предположить, что порины играют важную роль в развитии инфекционного процесса.

9. Порин из Y. pseudotuberculosis как диагностический антиген

ИФА тест-система для дифференциальной диагностики иерсиниозов. При исследовании иммунобиологических свойств иерсинина было показано, что иерсинин является видо- и родоспецифическим антигеном. Кроме того, антитела к нему присутствуют в сыворотках, полученных при иммунизации экспериментальных животных и в сыворотках больных псевдотуберкулезом. Эти факты послужили предпосылкой для использования иерсинина в качестве диагностического антигена.

Нами разработана диагностическая тест-система на основе ИФА с использованием ТСБ мономера иерсинина. При проверке возможности использования тест-системы для выявления псевдотуберкулеза у людей были исследованы 114 сывороток больных с характерными клиническими признаками и 79 индивидуальных донорских сывороток. Кроме того, учитывая выраженный полиморфизм псевдотуберкулезной инфекции, при апробации тест-системы были обследованы больные другими инфекционными заболеваниями, сходными по клинической картине с псевдотуберкулезом (сальмонеллез, иерсиниоз, гепатит) (рис. 40).

Сыворотки больных иерсиниозом и сальмонеллезом взаимодействуют с порином в диагностических разведениях, однако, значения оптической плотности псевдотуберкулезных сывороток выше в среднем почти в 3 раза (рис. 40). Это позволяет эффективно и достоверно осуществлять дифференциальную диагностику псевдотуберкулеза.

Рис. 40. Исследование сывороток крови больных и здоровых людей на наличие антител к возбудителю псевдотуберкулеза в ИФА с использованием иерсинина в качестве антигена: 1 ряд – контроль; 2 ряд – больные псевдотуберкулезом с бактериологически подтвержденным диагнозом; 3 ряд – больные кишечным иерсиниозом; 4 ряд - больные сальмонеллезом; 5 ряд – больные гепатитом.

На следующем этапе исследования мы сравнили статистически достоверные результаты серологического обследования больных псевдотуберкулезом с помощью разработанного нами ИФА и РНГА на основе коммерческого коммерческого типоспецифического диагностикума (в состав которого входит антигена Буавена из Y. pseudotuberculosis IВ серовара). Для этой цели были использованы 46 образцов сывороток крови людей с бактериологически подтвержденным диагнозом. Оказалось, что эффективность ИФА почти в два раза выше: с помощью РНГА положительная реакция обнаружена только в 52% случаев, а с помощью ИФА – в 98%, причем при использовании коммерческого диагностикума заболевание не выявлялось именно в тех случаях, когда возбудители псевдотуберкулеза принадлежали к 3 и 5 сероварам. Полученные результаты особенно важны для Дальневосточного региона России, где циркулируют возбудители 1, 3 и 5 сероваров псевдотуберкулеза. Преимуществом разработанной нами тест-системы является также возможность диагностики заболевания на ранних стадиях развития инфекционного процесса (7-10 дней от начала проявления клинических признаков).

Рис. 41. Эффективность ИФА тест-системы на основе порина из Y. pseudotuberculosi

при диагностике вторично-очаговых форм иерсиниозов.

При иерсиниозах часто отмечаются поражения опорно-двигательного аппарата (артрозы и артралгии неясной этиологии) и токсическое поражение сердечной мышцы (инфекционно-аллергический миокардит). Впервые с помощью разработанной нами тест-системы в сыворотках крови больных (65 человек) с различными формами артралгий в 42% случаев были обнаружены антитела к Y. pseudotuberculosis (рис.41). Исследование сывороток крови детей с кардиологическими патологиями с помощью данных тест-систем показало, что в 10 % случаев причиной заболевания мог быть перенесеный ранее псевдотуберкулез.

ВЫВОДЫ

1. Впервые из 5-ти видов бактерий рода Yersinia: 2-х патогенных для человека (Y. pseudotuberculosis и Y. enterocolitica) и 3-х непатогенных видов (Y. intermedia, Y. frederiksenii, Y. kristensenii) выделены неспецифические порообразующие белки НМ. Показано, что способ извлечения поринов влияет на стабильность и пространственную организацию функционально активной (тримерной) формы белка. Определены молекулярные массы и физико-химические свойства изолированных поринов иерсиний.

2. Установлена аминокислотная последовательность поринов из 5-ти видов иерсиний, и для поринов из Y. pseudotuberculosis и Y. enterocolitica, построены теоретические модели пространственной структуры.

3. Показано, что тримеры исследованных белков в искусственном бислое образуют каналы, по размерам и электрическим характеристикам типичные для OmpF подобных поринов энтеробактерий. Обнаружено, что, несмотря на высокую степень подобия первичной и пространственной структуры, порины патогенных и непатогенных иерсиний образуют каналы, отличающиеся по размеру и характеру распределения уровней проводимости.

4. Исследованы конформационные превращения порина из псевдотуберкулезного микроба под действием различных денатурирующих агентов. Показано, что вторичная структура белка обладает повышенной устойчивостью, а для более высоких уровней пространственной структуры порина (четвертичной  и третичной) характерна конформационная пластичность, приводящая к образованию частично развернутых конформационных интермедиатов, структуру которых определяют условия денатурации.

5. Обнаружено, что при изменении значений рН среды в дипазоне от 6,0 до 3,0, порин из Y. pseudotuberculosis имеет два конформационных перехода: функциональный и денатурационный. Первый происходит в слабокислой среде и проявляется в уменьшении проводимости пор на порядок (при рН 5,8) с последующим закрытием канала при рН 5,0. Денатурационный переход (при рН 4,0 – 3,5) связан с диссоциацией тримера на мономеры. Резкое изменение порообразующей активности в узком диапазоне значений рН может служить дополнительным механизмом адаптации иерсиний к изменению условий внешней среды.

6. На примере порина из псевдотуберкулезного микроба показано, что в качестве основного белкового компонента порины входят в состав ЛПБК – полного О-соматического антигена НМ грамотрицательных бактерий (антигена Буавена).

8. Обнаружено, что условия культивирования псевдотуберкулезного микроба влияют на пространственную структуру и функциональные свойства порина. Показана корреляция между липидным составом НМ и температурой выращивания бактерий с одной стороны и степенью упорядоченности пространственной структуры белка и его функциональными свойствами с другой.

9. Показано, что порообразующие белки НМ иерсиний являются родоспецифическими белками этих бактерий. Порины патогенных видов иерсиний могут быть использованы в качестве диагностических и протективных антигенов. Обнаружено что тримерная и мономерная молекулярные формы порина существенно различаются по эффективности защиты лабораторных животных от экспериментальной иерсиниозной инфекции.

10. Впервые на основе порина из НМ Y. pseudotuberculosis разработана ИФА тест-система для диагностики псевдотуберкулеза. Предлагаемая тест-система позволяет выявлять заболевание, вызываемое всеми сероварами псевдотуберкулезного микроба. По эффективности она в два раза превышает применяемый в клинической практике сухой эритроцитарный  диагностикум на основе антигена Буавена и может быть использована как для дифференциальной диагностики псевдотуберкулеза и кишечного иерсиниоза, так и для выявления некоторых иммунопатологий (вторично-очаговых форм иерсиниозов).

11. Впервые методом экспрессии в клетках E. coli получен рекомбинантный порин из Y. pseudotuberculosis, подобраны условия рефолдинга мономера и сборки функционально активного рекомбинантного тримера этого белка. Показана возможность использования рекомбинантного порина в качестве диагностического антигена.

12. Обнаружено, что порин из Y. pseudotuberculosis, является фактором вирулентности псевдотуберкулезного микроба, способствующим адгезии и инвазии бактерий в макроорганизм.

Список статей, опубликованных по теме дисертации

  1. Бондаренко (Новикова) О.Д., Соловьева Т.Ф., Шеховцева М. Ф., Недашковская Г.М., Гладких Р.В., Сорочан В.Д. Исследование липополисахарид-белкового комплекса из Yersinia pseudotuberculosis методом светорассеяния // Химия природн. соедин. 1979.  №1.  С. 51-53.
  2. Solov’eva T.F., Yermak I.M., Bondarenko  (Novikova) O.D., Frolova G.M., Ovodov Yu.S. Studies on lipopolysaccharide-protein complex from Yersinia pseudotuberculosis // Microbios.1979. Vol.25, No1.  P. 133-144.
  3. Бондаренко (Новикова) О.Д., Соловьева Т.Ф., Оводов Ю.С. Исследование белковой компоненты липополисахарид-белкового комплекса Yersinia pseudotuberculosis // Химия природн. соедин. 1980.  №1.  С. 92-97.
  4. Новикова О.Д., Набиуллин А.А., Соловьева Т.Ф., Оводов Ю.С. Выделение и характеристика белков внешней мембраны Yersinia pseudotuberculosis // Химия природн. соедин. 1983.  №3.- С. 359-366.
  5. Лихацкая Г.Н., Новикова О.Д., Соловьева Т.Ф., Оводов Ю.С. Выделение порообразующего белка из внешней мембраны Yersinia pseudotuberculosis и изучение его действия на проводимость бислой­ных липидных мембран // Биол. мембраны.  1985.  T. 2, № 12.  C. 1219-1224.
  6. Новикова О.Д., Зыкова Т.А., Ядыкина Г.М., Глазунов В.П., Соловьева Т.Ф., Оводов Ю.С. Изучение иерсинина - основного полипептида внешней мембраны Yersinia pseudotuberculosis // Биол. мембраны.  1985.  T. 2, № 7.  C. 714-723.
  7. Новикова О.Д., Урих Е.В., Тимченко Н.Ф., Соловьева Т.Ф., Оводов Ю.С. Использование имму­ноферментного анализа для антигенной характеристики пептидогликан-ассоциированного белка из внешней мембраны Y. pseudotuberculosis и обнаружения псевдотуберкулезного микроба в окружающей среде // В сб.: Вопросы микробиологии, патогенеза и лабораторной диагностики иерсиниозов.  Новосибирск, 1985. С. 33-38.
  8. Тимченко Н.Ф., Новикова О.Д., Ермак И.М., Соловьева Т.Ф. Компоненты наружной мембраны Yersinia pseudotuberculosis и их роль в патогенезе псевдотуберкулеза // Журн. микробиол.  1986.  № 6.  С. 38-41.
  9. Хоменко В.А., Новикова О.Д., Тимченко Н.Ф., Соловьева Т.Ф., Оводов Ю.С., Шубин Ф.Н. Изучение зависимости полипептидного состава внешней мембраны бактерий псевдотуберкулеза от температуры культивирования микроорганизмов // В сб.: Психрофильность патогенных микроорганизмов.  Новосибирск, 1986.  C. 46-50.
  10. Соловьева Т.Ф., Ермак И.М., Мороз С.И., Красикова И.Н., Новикова О.Д., Хоменко В.А., Фролова Г.М., Иванова Е.П., Тимченко Н.Ф., Оводов Ю.С. Влияние температуры культивирования на состав основных компонентов внешней мембраны Yersinia pseudotuberculosis // Биол. мембраны.  1988.  Т. 5, № 5.  С. 492-500.
  11. Новикова О.Д., Соловьева Т.Ф., Оводов Ю.С., Тимченко Н.Ф. Патент 1415496 Российская Федерация, МКИ4  А 61 К 39/02. Способ получения антигена из внешней мембраны бактериальных клеток; заявители и патентообладатели ТИБОХ ДВНЦ СО РАН СССР и НИИЭМ СО АМН СССР. - № 4010846/28-14; Заявл. 05.12.85; Опубл. 07.08.88, Бюлл. № 29.  3 с.
  12. Новикова О.Д., Лихацкая Г.Н., Фролова Г.М., Вострикова О.П., Хоменко В.А., Тимченко Н.Ф., Соловьева Т.Ф., Оводов Ю.С. Молекулярная организация и биологические свойств иерсинина-пори­на из псевдотуберкулезного микроба Yersinia pseudotuberculosis // Биол. мембраны.  1990.  T. 7.  № 5.  C. 453-461.
  13. Тимченко Н.Ф., Новикова О.Д., Павлова Г.Н., Венедиктов В.С., Соловьева Т.Ф. Протективные свойства порина из внешней мембраны Yersinia pseudotuberculosis // Журн. микробиол.  1990.  № 11.  C. 48-50.
  14. Ovodov Yu.S., Solovjeva T.F., Khomenko V.A., Novikova O.D., Frolova G.M., Yermak I.M., Naberezhnykh G.A. Porin as a component of Yersinia pseudotuberculosis endotoxin // Adv. Exp. Med. Biol. 1990.  V. 256. P. 185-187.
  15. Новикова О.Д., Федореева Л.И., Хоменко В.А., Портнягина О.Ю., Ермак И.М., Лихацкая Г.Н., Мороз С.В., Соловьева Т.Ф., Оводов Ю.С. Влияние способа экстракции порообразующего белка из Yersinia pseudotuberculosis на его макромолекулярную организацию // Биоорган. химия.  1993.  Т. 19.  №  5.  C. 536-547.
  16. Хоменко В.А., Новикова О.Д., Федореева Л.И., Лихацкая Г.Н., Борисова М.П., Вострикова О.П., Вакорина Т.И., Тимченко Н.Ф., Соловьева Т.Ф., Оводов Ю.С. Порин из Yersinia enterocolitica 0 : 3. Выделение и характеристика // Биол. мембраны.  1994.  Т. 11, № 1.  C. 68-79.
  17. Новикова О.Д., Портнягина О.Ю., Фролова Г.М., Соловьева Т.Ф., Павлова Т.Н., Тимченко Н.Ф., Прокопенкова А.П., Оводов Ю.С. Использование порина из внешней мембраны Yersinia pseudo­tuberculosis для серодиагностики псевдотуберкулеза // Бюлл. эксп. биол. мед..  1995.  № 8.  C. 199-202.
  18. Супотницкий М.В., Кравец И.Д., Новикова О.Д. Специфическая профилактика экспериментального сапа порином из Pseudomonas mallei // Ветеринария. 1995. Т. 119. №3. С. 24-27.
  19. Тимченко Н.Ф., Павлова Т.Н., Андрюков Б.Г., Венедиктов В.С., Новикова О.Д. Использование родоспецифического эритроцитарного диагностикума для выявления псевдотуберкулеза и иерсиниоза. // Клин. лаб. диагностика. 1998. №7. С. 32-34.
  20. Дармов И.В., Маракулин И.В., Погорельский И.П., Новикова О.Д., Портнягина О.Ю., Соло­вьева Т.Ф. Профилактика экспериментальной псевдотуберкулезной инфекции с помощью иммунизации по­рином из Yersinia pseudotuberculosis // Бюлл. эксп. биол. мед. 1999. Т. 127. № 2. C. 221-223.
  21. Новикова О.Д., Ким Н.Ю., Глазунов В.П., Вакорина Т.И., Набережных Г.А., Лихацкая Г.Н., Хоменко В.А., Соловьева Т.Ф. Влияние липополисахарида на конформационное состояние и функцио­нальную активность порина из Yersinia pseudotuberculosis // Биоорган. химия.  1999.  T. 25.  № 2.  С. 97-106.
  22. Новикова О.Д. Порины рода Yersinia // Успехи в изучении природных соединений. - Владивосток: Дальнаука, 1999.  С. 178-201.
  23. Портнягина О.Ю., Новикова О.Д., Вострикова О.П., Соловьева Т.Ф. Динамика иммунного от­вета к порину из наружной мембраны Yersinia pseudotuberculosis // Бюлл. эксп. биол. мед.  1999.  Т. 128.  № 10.  C. 437-440.
  24. Вострикова О.П., Лихацкая Г.Н., Новикова О.Д., Соловьева Т.Ф. Антигенное родство и функ­циональные свойства поринов рода Yersinia // Биол. мембраны.  2000.  Т. 17.  № 4.  C. 399-409.
  25. Вострикова О.П., Новикова О.Д., Дробков В.И, Дармов И.В., Маракулин И.В., Соловьева Т.Ф. Иммунный ответ к основному порообразующему белку наружной мембраны Yersinia pseudotuberculosis у людей и экспериментальных животных / Ред. журн. «Иммунология». - М., 2000. - 15 с.  Деп. в ВИНИТИ 28.03.00, № 795-В.
  26. Портнягина О.Ю., Вострикова О.П., Хоменко В.А., Новикова О.Д., Соловьева Т.Ф., Бениова С.Н., Малашенкова В.Г., Гордеец А.В. Апробация иммуноферментной тест-системы на основе белка порина из Yersinia pseudotuberculosis для диагностики псевдотуберкулезного (экстраинтестинального иерсиноза) у детей // Иммунология.  2000.  № 2.  C. 59-61.
  27. Гордеец А.В., Портнягина О.Ю., Вострикова О.П., Малашенкова В.Г., Бениова С.Н., Новикова О.Д., Соловьева Т.Ф. Патент 2153172 Российская Федерация, МПК7 G 01 N 33/53, 33/569. Способ диагностики псевдотуберкулеза; заявители и патентообладатели ВГМУ и ТИБОХ ДВО РАН. - № 98122085/14; Заявл. 02.12.98; Опубл. 20.07.00, Бюл. № 20. 8с.
  28. Портнягина О.Ю., Вострикова О.П., Хоменко В.А., Новикова О.Д., Соловьева Т.Ф., Бениова С.Н., Малашенкова В.Г., Гордеец А.В. Диагностика псевдотуберкулеза с помощью иммуноферментной тест-системы на основе белка порина из Yersinia pseudotuberculosis // Тихоокеан. мед. журн. 2001. № 2. C. 23-25.
  29. Вакорина Т.И., Новикова О.Д., Красикова И.Н., Набережных Г.А., Соловьева Т.Ф., Оводов Ю.С. Влияние структуры на взаимодействие липополисахарида с порином наружной мембраны Yersinia pseudotuberculosis // Исследовано в России [Электронный ресурс]: многопредмет. научн.  журн.  2002. Т. 117. С. 1285-1301. Режим доступа к журн.: http.://zhurnal.ape.relarn.ru
  30. Вакорина Т.И., Новикова О.Д., Красикова И.Н., Набережных Г.А., Соловьева Т.Ф., Оводов Ю.С. Взаимодействие порина из Yersinia pseudotuberculosis с различными структурными вариантами эндогенных липополисахаридов // Биохимия.  2003.  Т. 68,  вып. 9.  С. 1193-1202.
  31. Issaeva M.P., Guzev K.V., Novikova O.D., Solovjeva T.F., Degtyarev S., Rasskazov V.A. Porin from Yersinia pseudotuberculosis: cloning and analysis of primary structure //.Adv. Exp. Med. Biol. 2003. V. 529. No 2. P. 257-260.
  32. Vostrikova O.P., Novikova O.D., Kim N.Yu., Likhatskaya G.N., Solovjeva T.F. Pore-forming proteins of genus Yersinia //. Adv. Exp. Med. Biol.  2003. V. 529. No 2. P. 261-263.
  33. Ли И.А., Попов А.М., Санина Н.М., Костецкий Э.Я., Новикова О.Д., Реунов А.В., Нагорская В.П., Портнягина О.Ю., Хоменко В.А., Шныров В.Л. Физико-химические и иммунологические свойства гликоглицеролипидов из Laminaria japonica в составе иммуностимулирующих комплексов (ISCOM) // Изв. РАН. Сер. биол.  2004.  № 3.  С. 299-304.
  34. Портнягина О.Ю., Новикова О.Д., Вострикова О.П., Хоменко В.А., Соловьева Т.Ф. Бактериальные порины как перспективные антигены для диагностики и вакцинопрофилактики инфекционных заболеваний // Вестник ДВО РАН.  2004.  №  3.  С. 35-44.
  35. Lee I.A., Popov A.M., Sanina N.M., Kostetsky E.Y., Novikova O.D., Reunov A.V., Nagorskaya V.P., Shnyrov V.L. Morphological and immunological characterization of immunostimulatory complex based on glyco­glycerolipids from Laminaria japonica // Acta Biochim. Polonica.  2004.  V. 51.  No 1.  P. 263-272.
  36. Гузев К.В., Исаева М.П., Новикова О.Д., Соловьева Т.Ф., Рассказов В.А. Молекулярная харак­теристика OmpF-подобных поринов патогенных Yersinia // Биохимия.  2005.  Т. 70.  вып. 10.  С. 1338-1345.
  37. Вострикова О.П., Ким Н.Ю., Лихацкая Г.Н., Гузев К.В., Вакорина Т.И., Хоменко В.А., Новикова О.Д., Соловьева Т.Ф. Структура и функция порообразующих белков бактерий рода Yersinia  I. Выделение и сравнительная характеристика физико-химических свойств и функциональной активности поринов иерсиний // Биоорган. химия.  2006.  Т. 32. № 4.  С. 371-383.
  38. Антонец Д.В., Бакулина А.Ю., Портнягина О.Ю., Сидорова О.В., Новикова О.Д., Максютов А.З. Предсказание антигенно-активных районов OmpF-подобного порина Yersinia pseudotuberculosis // Докл. АН.  2007. Т.414.  №4. С. 1-3.
  39. Ким.Н.Ю., Новикова О.Д., Хоменко В.А., Лихацкая Г.Н. Вострикова О.П., Емельяненко В.И., Кузнецова С.М., Соловьева Т.Ф. Влияние рН на структуру и функциональную активность порина из наружной мембраны Yersinia pseudotuberculosis. Сообщение 1. Конформационные переходы иерсинина под влиянием рН являются функционально значимыми  // Биол. мембраны. 2007.  Т.24.  № 2.  С. 150-158.
  40. Новикова О.Д., Ким Н.Ю., Лукьянов П.А., Емельяненко В.И., Кузнецова С.М., Лихацкая Г.Н., Соловьева Т.Ф. Влияние рН на структуру и функциональную активность порина из наружной мембраны Yersinia pseudotuberculosis (иерсинина) Сообщение 2. рН-Индуцированные конформационные интермедиаты порина из наружной мембраны Y. pseudotuberculosis  // Биол. мембраны. 2007. Т. 24. №2. С. 159-168.

1 max S-формы = 315-317 нм; max формы I = 330-332 нм; max формы II = 340-343 нм),  max  формы III = 350-353 нм

2 Программа разработана А.М. Максютовым с соавторами, ВНИИ молекулярной биологии НПО «Вектор»

 






© 2011 www.dissers.ru - «Бесплатная электронная библиотека»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.