WWW.DISSERS.RU

БЕСПЛАТНАЯ ЭЛЕКТРОННАЯ БИБЛИОТЕКА

   Добро пожаловать!


На правах рукописи

Бакунина Ирина Юрьевна

О-ГЛИКОЗИДГИДРОЛАЗЫ МОРСКИХ БАКТЕРИЙ

02.00.10 — биоорганическая химия

Автореферат диссертации на соискание ученой степени доктора химических наук

Владивосток — 2011

Работа выполнена в Учреждении Российской академии наук Тихоокеанском институте биоорганической химии Дальневосточного отделения РАН

Научный консультант: доктор химических наук, профессор Звягинцева Т.Н.

Официальные оппоненты: доктор химических наук, профессор Шибнев В.А.

доктор химических наук, профессор Лукьянов П.А.

доктор биологических наук, с.н.с. Пивненко Т.Н.

Ведущая организация: Учреждение Российской академии наук Институт биоорганической химии им. академиков М.М. Шемякина и Ю.А. Овчинникова РАН

Защита состоится _______________2011 г., в ___ часов на заседании диссертационного совета Д 005.005.01 в Учреждении Российской академии наук Тихоокеанском институте биоорганической химии ДВО РАН по адресу: 690022, г. Владивосток, проспект 100 лет Владивостоку, 159, ТИБОХ ДВО РАН.

Факс: (4232) 314-050, e-mail: dissovet@piboc.dvo.ru

С диссертацией можно ознакомиться в филиале Центральной научной библиотеки ДВО РАН (г. Владивосток, проспект 100 лет Владивостоку, 159, ТИБОХ ДВО РАН).

Автореферат разослан " " 2011 г.

Ученый секретарь диссертационного совета, к.б.н. Черников О.В.

ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ



Актуальность исследования. Изучение О-гликозидгидролаз (ЕС 3.2.1.-), ферментов, катализирующих гидролитическое расщепление О-гликозидной связи в углеводах и углеводсодержащих биополимерах, является актуальной задачей.

Эти ферменты наиболее востребованы современной биотехнологией и широко используются для нужд пищевой, фармакологической, легкой промышленности и других областей. Они являются ключевыми ферментами углеводного обмена как в высших организмах, так и в микроорганизмах, поэтому знания об их свойствах, структуре и механизме действия необходимы для понимания многих процессов, происходящих в клетке. Кроме того, индивидуальные гликозидгидролазы с установленной субстратной специфичностью являются точными инструментами структурного анализа соответствующих природных полисахаридов и углеводсодержащих биополимеров.

Большой научный и практический интерес О-гликозидгидролазы представляют при исследовании и модификации антигенной структуры различных биологических объектов. Частным случаем энзиматической модификации антигенов является направленное изменение групповой специфичности эритроцитов крови человека групп А и В в эритроциты группы O, которое нашло применение в биотехнологии создания "универсальной крови" из крови доноров разной групповой принадлежности. Для конверсии эритроцитов необходимы специфические экзогликозидазы, способные при нейтральных значениях рН и физиологических температурах эффективно катализировать удаление терминальных -1,3-связанных иммунодоминантных остатков N-ацетилгалактозамина и галактозы, которые определяют групповую специфичность А- и В-эритроцитов соответственно. На сегодняшний день имеются сведения о двух таких ферментах из клинических бактериальных патогенов. Сообщения о подобных ферментах из морских бактерий в литературе отсутствуют.

Фукоиданы — семейство как гомо- и гетерополисахаридов, основная цепь которых построена из остатков сульфатированной L-фукозы, связаных преимущественно -1,3- и/или -1,4-О-гликозидными связями, так и полисахаридов с высоким содержанием глюкуроновой кислоты и низким содержанием фукозы и сульфатов. Остатки галактозы, маннозы, ксилозы, рамнозы также найдены в различных фукоиданах. Фукоиданы обнаружены только в морских организмах.

Высоким содержанием этих полисахаридов отличаются бурые водоросли.

Подобные полисахариды также выделены из экстрацеллюлярного матрикса тела кукумарии и обнаружены на поверхности оболочки яйцеклеток у различных видов морских ежей.

Фукоиданы проявляют широкий спектр биологического действия на различные системы организма млекопитающих. Известны их антикоагулянтная, антиангиогенная, антивирусная, антиопухолевая, антиоксидантная и другие виды активностей, т.о. они имеют значительный потенциал как терапевтические агенты.

В настоящее время возрастает интерес к фукоиданам, как к основе для создания эффективных медицинских препаратов нового поколения. В связи с этим, важной проблемой является определение тонкой химической структуры этих биополимеров для корреляции с их биологической активностью.

Большие надежды в процессе изучения структуры фукоиданов возлагают на метод селективной деградации этих полисахаридов с помощью ферментов — фукоиданаз. Ферментативное расщепление этих полисахаридов также необходимо для трансформации их с целью получения новых соединений, проявляющих биологические свойства.

Фукоиданазы — гликозидгидролазы, катализирующие гидролиз О-гликозидных связей основной цепи фукоиданов, остаются наименее изученным семейством О-гликозидгидролаз. С невысоким уровнем активности они обнаружены только у обитателей морской среды. Несмотря на многолетние усилия ряда исследовательских коллективов, в настоящее время нет коммерческого препарата данного фермента с охарактеризованными свойствами и субстратной специфичностью.

В качестве источников -галактозидазы, -N-ацетилгалактозаминидазы и фукоиданазы наибольший интерес представляют морские бактерии. Бактерии играют ключевую роль в метаболических процессах морских экосистем. Быстрый ответ микроорганизмов на экологические изменения, их важные функции в экосистемах обеспечиваются разнообразными ферментными системами.

Гетеротрофные аэробные облигатно морские бактерии привлекают все большее внимание как источники ферментов с оригинальными свойствами и специфичностью, так как они легко культивируются, обладают высокой скоростью размножения и позволяют осуществлять биосинтез веществ в контролируемых условиях. Кроме того, генетический материал уникальных бактерий можно использовать для создания суперпродуцентов рекомбинантных ферментов на основе легко культивируемых известных технологичных штаммов.

Современное развитие генетической инженерии и морской аквакультуры позволяет рассчитывать на создание новых биотехнологических процессов, альтернативных экологически деструктивной крупномасштабной добыче морской биомассы для получения ферментов.

Целью исследования являлось изучение О-гликозидгидролаз из истинно морских гетеротрофных бактерий, имеющих биотехнологический потенциал:

-N-ацетилгалактозаминидаз и -галактозидаз, пригодных для получения "универсальной крови", а также фукоиданаз, участвующих в биодеградации биологически активных полисахаридов бурых водорослей — фукоиданов.

Для достижения поставленной цели необходимо было решить следующие задачи:

- исследовать особенности распространения -N-ацетилгалактозаминидаз и -галактозидаз среди морских бактерий, собранных в различных акваториях Мирового океана;

- провести поиск -N-ацетилгалактозаминидаз и -галактозидаз, удаляющих иммуннодоминантные моносахариды от углеводных составляющих антигенов эритроцитов крови человека при нейтральных значениях рН, - из перспективных источников выделить -N-ацетилгалактозаминидазу и -галактозидазу в гомогенном состоянии, охарактеризовать их основные биохимические свойства и субстратную специфичность;

- изучить действие -N-ацетилгалактозаминидазы и -галактозидазы на эритроциты крови человека группы А и В, а также действие -галактозидазы на клетки буккального эпителия и патогенной бактерии Corynebacterium diphtheriae;

- установить первичную структуру, пространственную организацию, механизм действия -галактозидазы и её принадлежность к определённому семейству гликозидгидролаз;

- провести поиск ингибиторов -галактозидазы среди морских природных соединений, а также их синтетических производных;

- выполнить иммобилизацию -галактозидазы в полисахаридсодержащих нанокомпозитных материалах;

- получить высокоочищенный образец фукоидана, охарактеризовать элементы его структуры и обусловленные ими биологические свойства;

- провести поиск фукоиданаз среди бактерий-эпифитов и ассоциантов морских животных Охотского и Японского морей, исследовать особенности их распространения среди -протеобактерий и бактероидов, используя высокоочищенный субстрат;

- изучить особенности деградации фукоиданов из бурых водорослей Fucus evanescens и Laminaria cichorioides под действием ферментов из морских бактерий, принадлежащих к различным таксонам и культивируемых на различных по составу питательных средах;

- определить области практического применения ферментов.

На защиту выносятся следующие положения:

1. Облигатно морские бактерии, обитающие в Охотском и Японском морях, являются перспективными источниками -N-ацетилгалактозаминидаз, -галактозидаз и фукоиданаз.

2. -N-ацетилгалактозаминидаза из морской бактерии Arenibacter latericius KMM 426T удаляет иммунодоминантные -1,3-связанные остатки N-ацетилгалактозамина от невосстанавливающего конца углеводной составляющей антигенных детерминант эритроцитов человека группы крови А.

3. -Галактозидаза из морской -протеобактерии Pseudoalteromonas sp. КММ 701 удаляет иммунодоминантные -1,3-связанные остатки галактозы от невосстанавливающего конца углеводной составляющей антигенных детерминант эритроцитов человека группы В. Фермент имеет свободную SH-группу, важную для проявления активности; по биохимическим свойствам, субстратной специфичности, первичной и пространственной структуре он относится к 36-ому семейству О-гликозидгидролаз.

4. Иммобилизация -галактозидазы в гибридные полисахарид-силикатные нанокомпозитные материалы увеличивает уровень ее активности и стабильность.

5. Влияние полигидрокси-1,4-нафтохинонов на гидролитическую активность тиоловой -галактозидазы из Pseudoalteromonas sp. KMM 701 зависит от природы заместителей, их числа и положения в структуре соединений: эхинохром А не влияет на активность фермента, ди- и тригалогензамещенные нафтазарины являются необратимыми ингибиторами -галактозидазы.

6. Фукоидан из бурой водоросли F. evanescens, освобожденный от полифенольных соединений, сохраняет структурные характеристики и биологические свойства исходного полисахарида. Образец полисахарида пригоден для использования в качестве субстрата при поиске фукоиданаз, изучении их свойств и субстратной специфичности.

7. Фукоиданазы с невысоким уровнем активности широко распространены как среди бактерий-эпифитов бурых водорослей, так и среди изолятов морских иглокожих. Лучшими продуцентами являются бактерии родов Alteromonas и Pseudoalteromonas филума Proteobacteria, а также бактерии семейства Flavobacteriaceae типа Bacteroidetes.

8. -Протеобактерия Pseudoalteromonas issachenkonii KMM 3549T, а также бактероиды семейства Flavobacteriaceae, такие как Mesonia algae КММ 3909Т, Maribacter sp. КММ 6211 и Gramella sp. КММ 6054 содержат ферменты, участвующие в деградации как нейтральных, так и полианионных полисахаридов бурых водорослей, в том числе — фукоиданазы. Уровень активности фукоиданаз в клетках этих бактерий невысок и варьирует в зависимости от состава питательной среды.

9. Фукоиданазы из штаммов бактерии Pseudoalteromonas citrea, которые являются эпифитами бурых водорослей F. evanescens и Chorda filum, а также ассоциантами голотурии Apostichopus japonicus, катализируют гидролиз доступных -1,3-О-гликозидных связей в фукоиданах из L. cichorioides и F. evanescens по эндо-типу, образуя в качестве продуктов сульфатированные -L-фукоолигосахариды.

Научная новизна и практическая ценность работы. Впервые выполнено крупномасштабное исследование распространенности О-гликозидгидролаз среди бактериальных изолятов различных экотопов Охотского, Японского, ЮжноКитайского, Кораллового морей, литорали Сейшельских о-в, о-в Кука и других акваторий Мирового океана.

Впервые в морских бактериях найдены гликозидгидролазы, модифицирующие эритроциты и гликопротеины крови человека группы А и В: -галактозидаза из Pseudoalteromonas sp. КММ 701, -N-ацетилгалактозаминидаза из Arenibacter latericius КММ 426Т, проведено их выделение и очистка; впервые показано, что -галактозидаза из морской бактерии нарушает углеводные структуры, экспрессированные на поверхности эпителиоцитов человека и бактерий С.

diphteriae.

Установлена полная аминокислотная последовательность -галактозидазы и принадлежность ее к 36 семейству О-гликозидгидролаз. Впервые методом сравнительного моделирования получены теоретические модели пространственной структуры -галактозидазы Pseudoalteromonas sp. КММ 701, её каталитического домена и комплекса с конкурентным ингибитором галактозой. На основании результатов этих исследований установлены функционально значимые участки в молекуле фермента и их роль в катализе.

Выполнена иммобилизация -галактозидазы в гибридных нанокомпозитных материалах, содержащих полисахариды, в результате чего увеличилось время функционирования фермента и его термостабильность.

Среди природных и синтетических полигидрокси-1,4-нафтохинонов обнаружены ингибиторы -галактозидазы; наиболее значительным необратимым ингибирующим действием отличались хлорпроизводные этих соединений.

Из бактерии Pseudoalteromonas citrea выделен фермент, который катализирует гидролиз доступных -1,3-О-гликозидных связей в фукоиданах из L. cichorioides и F. evanescens и является 1,3--L-фуканазой (ЕС 3.2.1.-).

Результаты исследований защищены патентами и позволят достичь конечной практической цели — применения ферментов морских бактерий и их рекомбинантных форм в медицине, структурной химии углеводов и генной инженерии.

Апробация результатов. Результаты диссертационной работы были представлены в виде постерных сообщений и устных докладов на следующих Региональных, Всероссийских и Международных конференциях и симпозиумах:

45th Arctic Science Conference "Bridges of the science between North America and the Russian Far East" (Vladivostok, Russia, 1994), PICIES Workshop on the Okhotsk Sea and Adjacent Areas (Vladivostok, Russia, 1995), 2-ом Cъезде биохимического общества (Москва, Россия, 1997), Proceedings Сonference Oceanology International 97 Pacific Rim (World Trade Center, Singapore, 1997), Научной конференции ТИБОХ ДВО РАН "Исследования в области физико-химической биологии и биотехнологии" (Владивосток, Россия, 1998), IX Pacific Science Inter-Congress (Taipei, Taiwan, 1998), 2-ом Международном симпозиуме "Химия и химическое образование" (Владивосток, Россия, 2000), Научной конференции "Биоактивные вещества из морских макро- и микроорганизмов и наземных растений Дальнего Востока" (Владивосток, Россия, 2001), 9th International Symposium on Microbial Ecology (Amsterdam, Holland, 2001), Science Cnference on Marine Biotechnology (Shizuoka, Japan, 2001), 18th European Conference on Biomaterials (Stuttgart, Germany, 2003), Региональной научной конференции "Исследования в области физико-химической биологии и биотехнологии" (Владивосток, Россия, 2004), XVIII International Seaweed Symposium (Bergen, Norway, 2004), "2004 International Meeting of the Federation of Korean Microbiological Societies" (Seoul, Korea, 2004), V Всероссийском научном семинаре и молодежной школе "Химия и медицина" (Уфа, Россия, 2005), PICES XIV (Vladivostok, Russia, 2005), 31st FEBS congress (Turkey, 2006), II Региональной научной конференции "Исследования в области физико-химической биологии и биотехнологии" (Владивосток, Россия, 2006), 1st Far-Eastern International Symposium on Life Sciences (Vladivostok, Russia, 2008), IV съезде Российского общества биохимиков и молекулярных биологов (Новосибирск, Россия, 2008).

Публикации. По теме диссертационной работы опубликовано 26 статей в отечественных и международных журналах и 37 тезисов докладов в сборниках трудов Региональных, Всероссийских и Международных конференций и симпозиумов. Штаммы-продуценты, способы получения ферментов защищены тремя патентами РФ.

Структура и объём диссертации. Работа состоит из введения, литературного обзора, результатов и их обсуждения, экспериментальной части, заключения, выводов и списка цитируемой литературы, включающего 5источников. Работа изложена на 276 страницах, содержит 50 таблиц и 79 рисунков.

Автор искренне благодарен научному руководителю и учителю, д.х.н., проф.

Еляковой Л.А. и научному консультанту, зав. лабораторией химии ферментов, д.х.н., проф. Звягинцевой Т.Н. за ценные советы, глубокий и критический анализ и помощь в работе. Автор глубочайше признателен всем сотрудникам лаборатории химии ферментов и других лабораторий и подразделений ТИБОХ ДВО РАН, принимавшим участие в работе: к.х.н. Сова В.В., к.х.н. Шевченко Н.М., н.с.

Киселёвой М.И., к.б.н. Кусайкину М.И., к.б.н. Бурцевой Ю.В., к.х.н. Ермаковой С.П., д.б.н., член.-кор. РАН Михайлову В.В., д.б.н. Недашковской О.И., д.б.н. Ивановой Е.П., к.б.н. Шевченко Л.С., д.б.н. Пивкину М.В., к.б.н. Рассказову В.А., к.б.н.

Балабановой Л.А., к.ф-м.н. Лихацкой Г.Н., к.ф-м.н. Исакову В.В., к.ф-м.н. Глазунову В.П., н.с. Ким Н.Ю., вед. инженеру-электронику Кулешу Ю.Г., д.х.н. Ануфриеву В.Ф., д.х.н. Новикову В.Л., к.х.н. Похило Н.Д., к.х.н. Шестак О.П., к.х.н. Кольцовой Е.А., к.х.н. Чикаловец И.В. Автор также благодарен за плодотворное сотрудничество в работе сотруднику Института химии ДВО РАН д.х.н., член.-кор. РАН Щипунову Ю.А., сотрудникам Института микробиологии и эпидемиологии РАМН, акад. РАМН Беседновой Н.Н., д.б.н. Запорожец Т.С., д.б.н. Кузнецовой Т.А., к.б.н. Макаренковой И.Д., сотрудникам Института органической химии им. Н.Д. Зелинского РАН, д.х.н., проф. Усову А.И., к.х.н. Лихошерстову Л.М. и к.х.н. Мартыновой М.Д., сотрудникам Гематологического научного центра РАМН к.б.н. Кульману Р.А. (посмертно), д.б.н., проф. Макарову В.А., к.б.н. Дрозд Н.Н., сотруднику Института биохимии им. А.Н.

Баха РАН, д.х.н., проф. Рабиновичу М.Л.

СОДЕРЖАНИЕ РАБОТЫ

В обзоре литературы, состоящем из двух основных глав, даны общие представления о ферментах, относящихся к группе О-гликозидгидролаз (GH) 1.

Используемые сокращения: GH - гликозидгидролаза, GalА - -галактозидаза, NАGalА - N-ацетилгалактозаминидаза, NAGlcВ - -N-ацетилглюкозаминидаза, F2 - фукоидан из бурой водоросли Fucus evanescens, освобожденный от недиализуемых полифенолов, FL - фукоидан из бурой водоросли Laminaria cichorioides, FucА - -фукозидаза, GlcВ - -глюкозидаза, PsGalА – -галактозидаза из морской бактерии Pseudoalteromonas sp. KMM 701, TmGalА - -галактозидаза из термофильной бактерии Thermotoga maritima, OsGalА – -галактозидаза из культуры клеток Oryza sativa, pNPHGal - п-нитрофенил--D-галактопиранозид, pNPHNAcGal - п-нитрофенил-N-ацетил-D-галактозаминид, U - стандартная единица активности фермента (мкмоль/мин/мл), а.о. – аминокислотный остаток, АЧТВ - активированное частичное тромбопластиновое время, ГВК-А, ГВКВ и ГВК-Н - групповые вещества крови А, В и Н соответственно, БСА - бычий сывороточный альбумин, н.п. - нуклеотидная последовательность, п.н. – пара нуклеотидов, ОРС - открытая рамка считывания для белка, КД - круговой дихроизм, ТГЭОС - тетракис(2-гидроксиэтил)ортосиликат, Cat-HEC - катионное производное гидроксиэтилцеллюлозы, ЛБГ - галактоманнан бобов белой Описано распространение, свойства, классификация, структура и механизм действия -галактозидаз и -N-ацетилгалактозаминидаз — представителей различных семейств GH. Основное внимание уделено ферментам, которые используются в биотехнологии получения универсальной крови из донорских эритроцитов разных групп. Обобщены немногочисленные сведения о фукоиданазах — ферментах, принимающих участие в деградации фукоиданов.

РЕЗУЛЬТАТЫ И ОБСУЖДЕНИЕ 1. Гликозидазы морских бактерий, инактивирующие групповую специфичность эритроцитов крови человека -Галактозидаза (GalA) (ЕС 3.2.1.22) и -N-ацетилгалактозаминидаза (NАGalА) (ЕС 3.2.1.49) — О-гликозидгидролазы, катализирующие отщепление соответственно остатков галактозы (D-Gal) и N-ацетамидо-2-дезокси--Dгалактопиранозы (NAcGal), связанных -гликозидной связью, от невосстанавливающих концов различных олигосахаридов, разветвленных полисахаридов, а также гликозидов и углеводных составляющих различных природных гликоконъюгатов. Ферменты, удаляющие иммунодоминантные -1,3-связанные остатки D-Gal и NAcGal эритроцитов крови групп В (ЭЧ-B), А (ЭЧА) и АВ, трансформируя их в эритроциты "универсальной крови" О (ЭЧ-O) при нейтральный значениях рН, физиологической температуре и ионной силе, в условиях, когда красные клетки сохраняют жизнеспособность, представляют большой практический интерес для решения проблем трансфузионной медицины.

В литературе приводились сведения об успешном переливании добровольцам "универсальной крови", полученной путем ферментативной обработки при рН 5,ЭЧ-В -галактозидазой из зерен кофе. Так как фермент имеет кислый рН-оптимум действия (3,5-4,0), процедура обработки опытной партии эритроцитов требовала больших количеств дорогостоящего ферментного препарата. Имеются сообщения об GalA и NАGalА из клинических штаммов анаэробных симбиотрофных и патогенных бактерий Bacteroides fragilis и Elisabethkingia meningoseptica соответственно, эффективно действующих при ~ рН 7,0, которые полностью конвертировали ЭЧ-В и -А в ЭЧ-О. Сведения о подобных ферментах из морских бактерий отсутствуют.

Тихоокеанский институт биоорганической химии ДВО РАН обладает обширной коллекцией морских бактерий, собранных в различных районах Мирового океана во время экспедиций научно-исследовательского судна "Академик Опарин".

Первая часть работы посвящена исследованию GalA и NАGalА из морских бактерий.

1.1 Распространение -галактозидаз и -N-ацетилгалактозаминидаз среди морских бактерий Проведен поиск GalA и NАGalА среди 2008 и 860 морских бактерий соответственно. В качестве субстратов для тестирования активности ферментов использованы коммерческие хромогенные гликозиды: рNPHGal и рNPHNAcGal для GalA и NАGalА соответственно (0,1 М Na+-фосфатный буфер, рН 7,0).

Выполнен анализ распространения этих ферментов среди морских бактерий, изолированных из различных местообитаний Мирового океана.

В целом, из общего числа изученных штаммов 28% содержали GalA и 19% — NАGalА. Среди свободноживущих микроорганизмов штаммы-продуценты GalA и NАGalА встречались реже, чем среди изолятов животных (рис. 1). Продуценты акации, Мм - молекулярная масса, Да, Мr - молекулярная масса, а.е.м., CФ - спектры флуоресценции, Ме2+ - ионы двухвалентных металлов, НСТ-тест - тест с нитросиним тетразолием, ИС - индекс сравнения, ЭЧ-А, ЭЧ-В, ЭЧ-О - эритроциты человека группы А, В и О.

GalA и NАGalА, выделенные из животных, составляли 15 и 12% соответственно, из водорослей — 2 и 1%.

Рис. 1. Гистограмма, показывающая соотношение между общим числом исследованных штаммов бактерий, выделенных из различных экотопов Мирового океана, и количеством продуцентов -галактозидаз и -N-ацетилгалактозаминидаз.

Наибольшее количество продуцентов GalA было обнаружено у изолятов Охотского и Японского морей (~ 40%), тогда как продуценты NАGalА встречались среди них довольно редко (~ 14%) (рис. 2).

Рис. 2. Распределение продуцентов -галактозидаз и -N-ацетилгалактозаминидаз, по различным районам Мирового океана: Охотскому (I) и Японскому (II) морям, Тихому океану в районе островов Кука (III), Индийскому (IV) и Атлантическому океанам (V):

количество изученных штаммов (1), из них активных (2).

В Тихом океане у островов Кука почти половина изолятов являлись продуцентами и GalA, и NAGalA, тогда как в Атлантике у Канарских островов до 38% изолятов синтезировали GalA, а продуцентов NAGalA там не обнаружено. Не обнаружены продуценты ни GalA, ни NАGalА среди 326 изолятов Кораллового моря.

Анализ микробных популяций, выделенных из 50 морских животных и водорослей, показал, что GalA синтезировали бактерии (91%), ассоциированные с красной водорослью Polysiphonia sp., а также бактерии (~ 60%), ассоциированные с губками из Охотского моря. Заслуживают внимания микробные популяции голотурии Stichopus horrenes, собранной в районе островов Кука, почти 44% бактерий-ассоциантов которой синтезировали NАGalА, тогда как продуценты GalA среди них отсутствовали.

Следует отметить, что бактерии распространенного в морской среде филума Proteobacteria, рода Pseudoalteromonas проявили себя лучшими продуцентами GalA, тогда как NАGalА чаще встречались среди немногочисленных изолятов родов Aeromonas, Enterobacter, Pseudomonas.

Бактерии рода Pseudoalteromonas относятся к истинно морским представителям прокариот. Они способны утилизировать разнообразные природные субстраты, включая полисахариды водорослей. У некоторых штаммов, исследованных в представленной работе, была обнаружена способность гидролизовать агар-агар из красных водорослей Ahnfeltia sp., Gelidium amansii и др.

Скрининг 404 штаммов-агаролитиков рода Pseudoalteromonas из Коллекции морских микроорганизмов ТИБОХ ДВО РАН (КММ) выявил продуценты высокоактивных GalA среди свободноживущих псевдоальтеромонад (10%) и среди ассоциантов гидробионтов (27%), собранных в Охотском и Японском морях.

По результатам широкого скрининга были отобраны продуценты GalA и NАGalА. Клеточные экстракты этих штаммов, а также очищенные препараты ферментов были проверены по действию на ЭЧ и ГВК крови групп А и В в Гематологическом научном центре РАМН и Институте органической химии им. Д.Н.

Зелинского РАН. Для дальнейшего изучения выбраны два штамма бактерий под номерами КММ 426 и КММ 701, экстракты которых содержали NАGalА и GalA, инактивирующие серологическую активность эритроцитов А и В при рН 7,соответственно.

1.2 -N-ацетилгалактозаминидаза из бактерии Arenibacter latericius КММ 426T, устраняющая групповую специфичность А-эритроцитов В результате таксономического изучения фено-, фило- и генотипических характеристик новый изолят под номером КММ 426, выделенный из грунта ЮжноКитайского моря, был валидизирован как новый род и вид морских бактерий Arenibacter latericius КММ 426Т из семейства Flavobacteriacea филума Bacteroidetes.

В клеточном экстракте бактерии обнаружены следующие гликозидазы (mU/мг белка) 2: -N-ацетилглюкозаминидаза (NAGlcB) (32,0), NАGalА (0,44), GalA (0,14), -фукозидаза (FucА) (0,81), -маннозидаза (ManA) (0,14) и -ксилозидаза (XylB) (+).

Ферменты, деградирующие полисахариды, выявлены не были.

Процедура очистки NAGalA включала экстракцию дезинтегрированной биомассы, анионообменную хроматографию и гель-фильтрацию (табл. 1).

Таблица Очистка -N-ацетилгалактозаминидазы из биомассы Arenibacter latericius КММ 426Т Общая Удельная Стадии очистки Фракция Общий белок, Степень активность, активность, мг очистки mU mU/мг Экстракция 1570 677 0,4 II 380 547 1,4 3,DEAE-Sepharose CL-6В Sepharose CL-6В IIб 35 189 5,4 14,DEAE-Toyopearl-650 M IIб 6 139 23,1 57,После хроматографии на DEAE-Sepharose CL-6В были получены две белковых фракции (I и II), содержащие -N-ацетилгалактозаминидазную активность. Фракция I не сорбировалась на анионообменной смоле в условиях разделения. Фракция II, в свою очередь, была разделена гель-фильтрацией на два пика активности (IIа и IIб, минорный высокомолекулярный и основной ~ 80 кДа соответственно).

NAGalAIIб проявляет максимальную активность в районе значений рН 7,0-8,0.

Этот интервал значений рН является наиболее комфортным для проведения реакции конверсии ЭЧ-А в ЭЧ-О. NАGalAIIб сохраняет 100% активности в течение Стандартную активность гликаназ определяли по появлению восстанавливающих сахаров, образующихся в результате ферментативного гидролиза соответствующих полисахаридов. За единицу активности (U) принимали количество фермента, при действии которого образуется мкмоль восстанавливающих сахаров за 1 мин. Концентрацию восстанавливающих сахаров определяли по методу Нельсона, используя в качестве стандарта соответствующий моносахарид.

Стандартную активность гликозидаз определяли по п-нитрофенолу, выделившемуся в ходе гидролиза соответствующих коммерческих хромогенных гликозидов. Количество п-нитрофенола определяли спектрофотометрически при 400 нм (=18300 моль-1 см-1) и рассчитывали по формуле:

U = D400/(18,3V), мкмоль/минмл, где: V – объём аликвоты фермента (мл), - время реакции (мин). За единицу активности фермента (U) принимали такое его количество, которое катализировало образование 1 мкмоля п-нитрофенола в минуту.

30-минутного прогревания при 50°С и рН 7,2, длительное время активна при 4°С и в течение недели — при 20 °С в присутствии 0,1% азида натрия, выдерживает замораживание в виде суспензии при высоких концентрациях (NH4)2SO3. Как многие ферменты морских микроорганизмов, NАGalАIIб галотолерантна, а при концентрации NaCl, равной 0,5 М, ее активность возрастает почти вдвое (рис. 3).

Рис. 3. Зависимость активности -N-ацетилгалактозаминидазы из морской бактерии Arenibacter latericius КММ 426Т от концентрации NaCl в растворе 0,01 М Na+-фосфатного буфера, рН 7,2, 20С.

Константа Михаэлиса-Ментен (Кm) NАGalАIIб по pNPHNAcGal при рН 7,равна 0,60±0,07 mМ. Значение молекулярной массы NАGalАIIб по данным SDS-электрофореза в денатурирующих условиях составляет 48 кДа, а по результатам гель-фильтрации в физиологических условиях — 94 кДа. Этот факт свидетельствует о наличии четвертичной структуры у фермента, т.е. NAcGalАIIб в растворе образует гомодимер.

Методом ингибиторного анализа исследована роль отдельных аминокислотных остатков в каталитической активности NАGalАIIб (табл. 2).

Таблица Влияние химических реагентов на активность -N-ацетилгалактозаминидазы Концентрация Остаточная Реагент pH реакции реагента, М активность, % -п-Хлормеркурибензоат 7,2 1,8·-N-Этилмалеимид 7,2 1,8·-N-Бромсукцинимид 7,2 1,8·Карбодиимид 1,8·10-3 7,2 Ацетилимидазол 5,0·10-3 7,2 2,2' Дианизидин 2,0·10-3 7,2 Диэтилпирокарбонат 2,0·10-3 7,2 -EDTA 7,2 11,0·-1,0·2+ -7,2 Ca 1,0·2+ -7,2 1Mg 1,0·2+ -7,2 1Mn 1,0·-NAD(H) 7,2 11,0·-Азид натрия 7,2 13,0·Этанол 2% 7,2 1Ингибирование NАGalАIIб п-хлормеркурибензоатом и N-этилмалеимидом предполагает важное значение свободных SH-групп для проявления ферментативной активности этого фермента. Полная потеря активности фермента под действием карбодиимида может свидетельствовать о существенном значении карбоксильных групп остатков Asp и/или Glu, которые входят в активные центры всех известных гликозидаз, где выполняют различные функции. Окисление NAGalAIIб N-бромсукцинимидом при рН 7,2 также приводило к полной потере ее активности. Известно, что в указанных условиях, наряду с остатками Trp, могут быть задеты и имидазольные группы His, и свободные SH-группы остатков Cys.

Установлено, например, что у представителя семейства GH27, рекомбинантной NAGalA из печени цыпленка, остаток Trp16 участвует в образовании комплекса с субстратом. В активном центре NAGalA семейства GH109 остатков Trp не отмечено. Важным для проявления активности у этого фермента является His228.

Однако при действии диэтилпирокарбоната, растворенного в этаноле, на фермент из морской бактерии, сохранялось около 60% его активности. Растворитель, 2%ный этанол, не ингибировал NAGalAIIб.

EDTA незначительно снижала активность NAGalAIIб, ионы Са2+ полностью ее инактивировали, а в присутствии Mg2+ активность фермента возрастала на 30% (табл. 2). Экзогенные Mn2+ и NAD+ не влияли на активность NАGalАIIб. Зависимость гидролитической активности от присутствия ионов Ме2+ — отличительная черта только гликозидгидролаз семейства GH4, среди представителей которого -N-ацетилгалактозаминидаз пока не обнаружено. -N-ацетилгалактозаминидазы семейства GH109, эффективно конвертирующие ЭЧ-А в ЭЧ-О, являются NAD+ зависимыми ферментами, но не нуждаются в ионах Ме2+ для проявления активности.

Автоматическим методом Эдмана определена N-концевая аминокислотная последовательность нативной NАGalАIIб, состоящая из 15 а.о.

(GAKYMGGFSAPKLDT). Отмечено ее сходство с N-концевой последовательностью ферментов семейства GH109.

Изучено действие NАGalАIIб на ЭЧ-А и групповую специфичность ГВК-А. В таблице 3 показаны результаты иммунологического изучения нативных и обработанных ферментом ЭЧ-А.





Таблица Титр агглютинации донорских эритроцитов группы А до и после обработки -N-ацетилгалактозаминидазой Титр агглютинации Цоликлон-А 2 4 8 16 32 64 128 256 5анти-А + трансформированные ЭЧ-А - - - - - - - - анти-А + нативные ЭЧ-А + + + + + + + + - Видно, что все А-антигены трансформированы ферментом в Н-антигены, так как нет агглютинации с анти-А сывороткой. NАGalАIIб не вызывала неспецифической агглютинации эритроцитов и их гемолиза. Полная инактивация серологической активности ЭЧ-А может свидетельствовать о том, что NAGalAIIб модифицирует ЭЧ как группы А2, так и А1. Это отличает NAGalAIIб от NAGalA из печени цыпленка, бактерий R. torques IX-70265 и C. perfringens, которые конвертируют только ЭЧ-А2. На сегодняшний день полная конверсия ЭЧ-А в ЭЧ-О была достигнута только под действием рекомбинантного фермента из бактерии E.

meningoseptica.

Препарат NАGalАIIб проявлял высокую активность в реакции ингибирования гемагглютинации с групповым веществом крови А (ГВК А+Н), имеющим детерминанты, аналогичные таковым ЭЧ-А. Для установления типа действия NАGalАIIб, ГВК А+Н обрабатывали препаратом фермента, продукты ферментолиза разделяли гельфильтрацией. В низкомолекулярной фракции, предварительно подвергнутой кислотному гидролизу, был идентифицирован галактозамин (NАcGal), при практически полном отсутствии других моносахаридов. Это свидетельствовало о том, что NАGalАIIб является экзо-гликозидазой.

Таким образом, из морской бактерии A. latericius КММ 426Т выделена -N-ацетилгалактозаминидаза, представляющая большой практический и теоретический интерес. Благодаря способности действовать на ЭЧ-А и ГВК-А в нейтральной области рН она может быть весьма перспективной и как биохимический инструмент, и как фермент для получения универсальных эритроцитов из эритроцитов человека группы А.

1.3 -Галактозидаза бактерии Pseudoalteromonas sp. KMM 701, устраняющая групповую специфичность В-эритроцитов 1.3.1 Характеристика штамма Штамм облигатно морской бактерии, синтезирующий GalA c требуемыми свойствами, был выделен из воды Охотского моря. Исследование фенотипических признаков показало, что бактерия является гетеротрофной, аэробной, галофильной, психротолерантной, грамотрицательной, движущейся посредством единственного полярного жгутика.

По результатам филогенетического анализа нуклеотидных последовательностей гена 16S рРНК штамма KMM 701 (инвентарный номер GenBank EU661863) новый изолят относится к членам филума Proteobacteria, класса -Proteobacteria и образует кластер с непигментированными бактериями рода Pseudoalteromonas. Ближайшим филогенетическим родственником исследуемого штамма оказался штамм Pseudoalteromonas nigrifaciens NCIMB 8614T с гомологией последовательности гена 16S-рРНК 99,1%. Уровень гомологии последовательностей гена 16S-рРНК между KMM 701 и типовыми штаммами родственных видов достигал 98,9% для P. elyakovii KMM 162T и P. espejiana NCIMB 2127T, 98,8% для P. haloplanktis ATCC 14393T, P. distincta КММ 638T и P. paragorgia KMM 3548T, 98,7% для P. carrageenovora IAM 12662T, 98,6% для P. agarivorans KMM 255T, 98,4% для P. gracilis B9T и P. issachenkonii KMM 3549T, 98,1% для P. aliena KMM 3562T и 97,5% для P. antarctica CECT 4664T. Уровень гомологии последовательностей с другими видами бактерий рода Pseudoalteromonas был ниже 97,5%. На основании данных филогенетического анализа можно предположить, что штамм KMM 701 принадлежит новому виду в пределах рода Pseudoalteromonas.

В экстракте сырой биомассы бактерии Pseudoalteromonas sp. KMM 7обнаружены только 4 гликозидгидролазы (mU/мг белка): GalA (102,0±22,0) и GalВ (5,8±0,5), а также ламинараназа (12,4±1,7) и амилаза (8,04). По уровню активности GalA из Pseudoalteromonas КММ 701 (PsGalА) превосходила в 10-20 раз 3 других гликозидгидролазы.

Активность PsGalА появлялась в клетках бактерии после 5 ч культивирования и достигала максимального значения через 24 ч (рис. 4).

Рис. 4. Изменение биомассы бактерии Pseudoalteromonas sp. КММ 701 (1), общего белка (2), -галактозидазной активности (3) в процессе роста бактерии. Т — 26С, скорость вращения качалки — 120 об/мин, состав среды (г/л): бактопептон — 5,0, глюкоза — 1,0, K2HPO4 — 0,2, дрожжевой экстракт — 2,0, дистиллированная вода — 500 мл, стерильная морская вода — 500 мл, рН 7,8.

Показано, что для биосинтеза PsGalА бактерия не требует определенного индуктора и может расти на стандартной среде, содержащей глюкозу.

1.3.2 Выделение и основные свойства -галактозидазы В результате последовательности процедур, указанных в таблице 4, получен высокоочищенный препарат PsGalA.

Таблица Очистка -галактозидазы из Pseudoalteromonas sp. КММ 7Удельная Степень Общий белок, Общая Выход, Стадии очистки активность, очистки, мг активность, U % U/мг раз Экстракт 2094,2 230,4 0,11 0 140-80% (NH4)2SO4 1084,0 177,1 0,16 1,5 DEAE Toyopearl 650 M 20,0 115,2 5,76 52,4 Sepharose CL-4B 3,0 46,1 15,40 140,0 Source 15Q PE 4,6/100 0,12 27,6 231,00 2100,0 PsGalА проявляет максимальную активность в области значений рН 6,7-7,(рис. 5), термолабильна, при 37°С полностью теряет активность в течение 10 мин (рис. 6). Однако при 20°С фермент сохраняет активность более суток. Присутствие бычьего сывороточного альбумина (БСА) защищает PsGalА от термической денатурации (рис. 7).

Рис. 5. Зависимость начальной скорости Рис. 6. Термостабильность PsGalА.

гидролиза PsGalА от рН, 0,1 М Na+- Прогревание в течение 10 (1) и 30 (2) мин, ацетатно-фосфатно-боратный буфер. 0,02 М Na+-фосфатный буфер, рН 7,0.

Термолабильность свойственна ферментам морских психротолерантных бактерий, обитающих в водах северных морей, которые летом прогреваются только до 4°С.

Рис. 7. Зависимость активности PsGalА Рис. 8. Зависимость активности от времени выдерживания ее при 20° PsGalА от концентраций NaCl (1), (1), 25° (2) и 30С (3) в присутствии (а) мочевины (2) и гуанидинхлорида (3), и в отсутствии (б) 0,2% БСА, 0,02 М 0,02 М Nа+-фосфатный буфер, рН 7,0.

Na+-фосфатный буфер, рН 7,0.

Галотолерантность является также характерной чертой морских бактерий и, вероятно, их ферментов. Мочевина и гуанидинхлорид при низких концентрациях инактивируют фермент (рис. 8, кривые 2 и 3), что позволяет предполагать наличие у PsGalА четвертичной структуры.

Значение молекулярной массы PsGalА по результатам гель-фильтрации составляет 170±3 кДа, согласно данным SDS-электрофореза — 80,5±2,5 кДа. Это означает, что в физиологических условиях фермент имеет олигомерную структуру и состоит, по меньшей мере, из двух одинаковых субъединиц с величиной молекулярной массы, равной приблизительно 80 кДа. Такой результат согласуется с литературными данными, что почти все -галактозидазы бактерий имеют четвертичную структуру.

1.3.3 Субстратная специфичность -галактозидазы PsGalА отщепляет галактозу от мелибиозы (Gal1,6Glс), дисахарида Gal1,3Gal и трисахарида Gal1,3(Fuc1,2)Gal. Последний олигосахарид является концевым фрагментом структуры В-антигена на ЭЧ-В (табл. 5). Фермент из морской бактерии не действует на раффинозу, что отличает его от мелибиаз из наземных источников. Для оценки эффективности действия микробной -галактозидазы на ГВК-В было использовано одинаковое количество стандартных единиц изучаемого фермента и коммерческой -галактозидазы из зеленых бобов кофе.

Таблица Субстратная специфичность -галактозидазы Субстрат Действие pNPHGal + Gal1,3Gal + + Gal1,3(Fuc1,2)Gal + Gal1,6Glс - Gal1,6Glс1,2Fru + ГВК-В + ЭЧ-В - ЭЧ-А PsGalА оказалась существенно более активной на модели эритроцитарного антигена, чем кофейная GalA, использовавшаяся ранее в опытах по трансформации донорских эритроцитов для внутривенного введения. Установлено, что для достижения одинаковой инактивации ГВК-В требуется PsGalА примерно в раза меньше, чем GalA из зеленых бобов кофе.

1.3.4 Каталитические свойства -галактозидазы В таблице 6 представлены кинетические параметры гидролиза рNPHGal, катализируемого PsGalА.

Таблица Кинетические параметры гидролиза рNPHGal, катализируемого -галактозидазой Vmax, kсat/Km, Условия Km, mM kсat, мин-мкмоль/мин mM-1 мин-0,1 М Nа+-фосфатный буфер, рН 0,40±0,035 0,81±0,019 36,82 92,7,3, 20С, 0,1 М NaCl Величина константы Михаэлиса-Ментен (Km) PsGalА типична для бактериальных ферментов, тогда как величина kсat, равная 36,82 мин-1, является низкой по сравнению с таковыми для известных GalA из семейств GH27 и GH36.

PsGalА по эффективности действия на хромогенный гликозид (kсat/Km) в три раза превосходит GalA из Bacteroides fragilis (семейство GH110), которая проявляет более низкое сродство (Km = 0,70 mM) к рNPHGal, но эффективно конвертирует ЭЧ-В в ЭЧ-О.

Показано, что галактоза является конкурентным игибитором PsGalА (Ki = 1,mМ) (рис. 9 и 10).

Рис. 9. График Лайнуивера-Берка. Рис. 10. График Диксона. Зависимость Зависимость начальной скорости обратной скорости гидролиза 0,10, 0,21, гидролиза от концентрации рNPHGal в 0,42, 0,83 mМ рNPHGal от концентрации обратных координатах в присутствии 0, 1, Gal (зависимости 1, 2, 3, 2, 3 mМ галактозы (зависимости 1, 2, 3, 4 соответственно). Кi = 1,32 mМ; условия соответственно); 0,1 М Nа+-фосфатный эксперимента аналогичны указанным на буфер, рН 7,3, 20С, 0,1 М NaCl. рис. 9.

Тип ингибирования установлен c помощью графика Лайнуивера-Берка, из которого видно, что в присутствии возрастающих концентраций D-Gal увеличивается значение Km фермента при постоянной величине Vmax (рис. 9).

Величина константы ингибирования определена по графику Диксона (рис. 10).

Согласно литературным данным D-Gal ингибирует активность многих растительных -галактозидаз семейства GH27 по механизму конкурентного или смешанного ингибирования. Следует отметить, что D-Gal является слабым конкурентным ингибитором для GalA из термофильной бактерии Bacillus stearothermophilus (Кi = 16,25 mM), и не ингибирует GalA из термофильной археи Sulfolobus solfatariсus.

Вопрос о стереохимическом результате ферментативного гидролиза гликозидов является принципиальным при классификации О-гликозидгидролаз.

Конфигурацию аномерного центра D-Gal, образующейся при гидролизе pNPHGal под действием PsGalА, определяли с помощью 1Н ЯМР-спектроскопии. Появление в начале реакции в Н ЯМР-спектрах pNPHGal резонансного сигнала в виде дублета с равным 5,287-5,294, который соответствует протонам -аномерного центра D-Gal, свидетельствует о том, что PsGalА катализирует гидролиз -О-гликозидной связи с сохранением конфигурации аномерного центра субстрата, как все известные -галактозидазы клана GH-D. Представители семейства GH1являются "обращающими" гликозидгидролазами.

1.3.5 Действие -галактозидазы на антигены клеток человека и бактерий 1.3.5.1 Действие -галактозидазы на эритроциты человека Результаты иммунологического изучения нативных эритроцитов и обработанных PsGalА (рН 7,3, 26С, 24 ч) показаны таблице 7. Из таблицы видно, что В-антигены трансформированы в Н-антигены, так как отсутствует агглютинация с анти-В сывороткой. Титр агглютинации с анти-Н сывороткой закономерно увеличен за счёт появления новых Н-антигенов вместо В-антигенов. Полученные данные свидетельствуют также об отсутствии в препарате -фукозидазы. Титр агглютинации с анти-М или анти-N сыворотками не изменяется, что может указывать на отсутствие сиалидаз в изученном образце фермента. PsGalА не вызывала неспецифической агрегации эритроцитов и их гемолиза. При изучении субстратной специфичности фермента на ГВК выяснилось, что на фоне ярко выраженной активности к В-антигенам этот фермент не проявляет активности к А- и Н-антигенам.

Таблица Титры агглютинации нативных и трансформированных под действием -галактозидазы В эритроцитов Антисыворотка + В эритроциты Титр агглютинации 2 4 8 16 32 64 128 256 5Анти-В+трансформированные - - - - - - - - - Анти-В+нативные + + + + + + + + Анти-Н+трансформированные + + + + + - - - - Анти-Н+нативные + + - - - - - - Анти-М+трансформированные + + + + + - - - - Анти-М+нативные + + + + + - - - Анти-N+трансформированные - - - - - - - - - Анти-N+нативные - - - - - - - - Варьируя концентрацию PsGalА, ЭЧ-В и время их обработки ферментом, определили, что 0,24 U/мл фермента конвертируют 1 мл ЭЧ-В в 15-20% гематокрите в течение трех ч при 26С в 0,01 M K+-Na+-фосфатном буфере, рН 7,3.

1.3.5.2 Действие -галактозидазы на эпителиоциты человека Было исследовано влияние PsGalА на адгезию токсикогенного штамма Сorynebacterium diphtheriae к клеткам буккального эпителия. В работе использовали эпителиоциты донора с группой крови B. Установлено, что PsGalА эффективно снижала адгезию патогена (табл. 8).

Таблица Среднее количество бактерий токсикогенного штамма Сorynebacterium diphtheriae, прикрепившихся к одной эпителиальной клетке I II III Вариант опыта M±m p M±m p M±m p PsGalА 6,0±0,3 0,0005 4,7±0,2 0,0005 2,1±0,4 0,00Контроль 14,7±0,6 14,7±0,6 14,7±0,I — фермент инкубировали с микроорганизмами; II — фермент инкубировали с клетками буккального эпителия; III — фермент инкубировали с клетками буккального эпителия и адгезированными микроорганизмами; n=4.

Максимальный эффект достигался в том случае, когда ферментом обрабатывали клетки с уже прикрепившимися микроорганизмами. Это может быть обусловлено действием фермента на углеводные структуры как клеток бактерий, так и эпителиоцитов. Подобный эффект описан для протеолитических ферментов, действие которых приводит к нарушению уже сформированных колоний микроорганизмов, образующих биопленку. Полученные результаты демонстрируют возможность нарушения углеводных структур, экспрессированных на поверхности эпителиоцитов и бактерий, при действии PsGalА.

Известно, что буккальный эпителий, являясь частью мукозальной системы, сохраняет структурные элементы, которые обеспечивают взаимодействие с различными факторами внешней и внутренней среды. На клетках буккального эпителия идентифицированы различные варианты АВН изотипов углеводных цепей, соответствующие АВН антигенам эритроцитов индивидуума. Принимая во внимание способность АВН антигенов участвовать в различных cell-cell и cell-matrix взаимодействиях, результаты, демонстрирующие высокую антиадгезивную активность PsGalА, могут быть обусловлены, в числе прочих возможных факторов, специфичностью фермента, обеспечивающей нарушение углеводных структур, входящих в состав В-антигенов.

Таким образом, выделенная из морской бактерии Pseudoalteromonas sp. KMM 701 -галактозидаза представляет большой практический и теоретический интерес.

По действию на ГВК-В, ЭЧ-В и другие клетки организма человека и бактерий в нейтральной области значений рН, фермент может быть весьма перспективным не только как биохимический исследовательский инструмент, но и как один из реагентов для получения конвертированных универсальных эритроцитов из эритроцитов группы В.

1.3.6 Характеристика структуры -галактозидазы 1.3.6.1 Функционально значимые аминокислотные остатки Роль отдельных аминокислотных остатков в ферментативной активности PsGalА была исследована методом ингибиторного анализа (табл. 9). пХлормеркурибензоат натрия ингибировал активность фермента полностью, Nэтилмалеимид — на 95%, что говорит о важной роли SH-групп для активности PsGalA. Известно, что соединения с близко расположенными SH-группами (дитиолы) имеют высокое сродство к арсениту натрия и образуют циклические дитиоарсениты. Было показано, что арсенит не влияет на активность фермента.

Этот факт позволяет предположить, что в ближайшем окружении SH-группы, важной для активности PsGalA, нет других свободных сульфгидрильных групп.

В присутствии перекиси водорода наблюдалось значительное ингибирование активности PsGalА. Падение активности могло быть связано как с окислением свободных SH-групп Cys, так и остатков Met и Trp. Окисление N-бромсукцинимидом при различных значениях рН, которое сопровождалось полной потерей активности фермента, также может затрагивать SH-группы, но вероятнее всего в данном случае модифицируются остаток(и) Trp, играющие существенную роль в активном центре классических гликозидгидролаз.

Таблица Влияние химических реагентов на активность -галактозидазы pH реакции Остаточная активность, % Реагент Концентрация, М п-Хлормеркурибензоат 10-3 7,0 N-Этилмалеимид 10-3 7,0 Арсенит натрия 10-2 7,0 1Перекись водорода 10-1 7,0 10-3 5,5 N-Бромсукцинимид 10-3 6,3 10-3 7,0 10-4 7,0 1EDTA 10-3 7,0 1Ca2+ 10-3 7,0 1Mg2+ 10-3 7,0 1Азид натрия 7,0 1310-210-1 6,0 1Этанол 210-1 7,0 1На активность фермента не действовали ни EDTA, способная ингибировать активность металлозависимых ферментов, ни азид натрия. Катионы двухвалентных металлов также не требуются ферменту для проявления активности (табл. 9).

1.3.6.2 Определение первичной структуры -галактозидазы Последовательность из 15 а.о. (ADTNSFYRLDRVNST) с N-конца полипептидой цепи нативной PsGalА определили с помощью автоматического метода Эдмана. Полную аминокислотную последовательность PsGalА установили с помощью методов молекулярной биологии и генной инженерии. На основании анализа высоко консервативных участков первичной структуры -галактозидаз семейств GH27 и GH36, размещенных в GenBank (NCBI), были сконструированы вырожденные праймеры для амплификации первого специфического фрагмента гена, кодирующего PsGalА: прямой праймер (5'-RTNGAYGAYGGNTGGTT-3') на участок активного центра I/VDDGWF и обратный праймер (5'AT(A/C/T)CCCATRTGNCCRAA-3') на участок FGHMGI, где Y, N и R обозначают нуклеотиды C/T, A/C/G/T и A/G. В течение 44 циклов амплификации геномной ДНК при 55°C был получен единственный фрагмент гена длиной 705 п.н., который клонировали и секвенировали с помощью стандартных процедур. Для получения 5’- и 3’-концевых последовательностей, соответствующих открытой рамке считывания для предшественника белка (OРС), были синтезированы генспецифические праймеры, ориентированные в противоположные направления.

С помощью четырех из десяти эндонуклеаз рестрикции, которыми обрабатывали ДНК бактерии Pseudoalteromonas sp. KMM 701 для инверсированной ПЦР, были получены фрагменты ДНК, содержащие ген PsGalА. Фрагмент ПЦР длиной в 1000 п.н. был получен при амплификации лигированных в кольцо рестриктов EcoRI, AspS9I, Bpu14I, а фрагмент ПЦР длиной в 3000 п.н. был амплифицирован на PstI-фрагментах ДНК. Все рестрикционные фрагменты ДНК содержали N-концевой участок PsGalА, включая первый метионин. Фланкирующий участок гена длиной в 1200 п.н. со стороны 3’-конца, 453 п.н. которого соответствовали C-концевой части первичной структуры белка, был получен с использованием в ПЦР прямого ген-специфеского праймера 3’-CGTGCTGCGGTATCAATGTTC-5’.

В результате выполненных процедур выделен ген PsGalA, соответствующий ОРС для белка, состоящий из 2130 п.н. и кодирующий полипептидную цепь из 7а.о. Отсутствие потенциального сигнального пептида в выведенной аминокислотной последовательности подтверждает цитоплазматическую локализацию белка. Зрелая форма белка имеет расчетную молекулярную массу 80,050 кДа и изоэлектрическую точку — pI 5,6, что соответствует экспериментальным данным. Последовательность 15 а.о. с N-конца полипептидной цепи, выведенной из нуклеотидной последовательности гена, совпадает с результатами секвенирования, полученными методом Эдмана. Полная аминокислотная последовательность PsGalА характеризуется высоким содержанием отрицательно заряженных, незаряженных полярных и неполярных аминокислотных остатков, таких как Leu (10,28%), Ser (7,89%), Val (7,04%), Ala (7,04%), Glu (6,90%). Таким образом, установлена полная аминокислотная последовательность -галактозидазы из морской бактерии, модифицирующей антигены клеток.

1.3.6.3 Характеристика вторичной структуры -галактозидазы Содержание элементов вторичной структуры нативной PsGalА (0,01 М Na+фосфатный буфер, рН 7,3, 0,15 М NaCl, 20С) определяли экспериментально методом спектроскопии кругового дихроизма (КД). В области спектра КД фермента от 204 до 230 нм наблюдалась широкая отрицательная полоса с минимумом эллиптичности при 219 нм и двумя плечами вблизи 222 и 208 нм, а также положительная полоса с максимумом эллиптичности при 195 нм, что указывало на наличие как -спиралей, так и -структуры в полипептидной цепи фермента. На основании результатов анализа спектра КД с помощью пакета компьютерных программ CDPro было установлено, что PsGalА, наиболее вероятно, является + белком, который содержит 19,1% -спирали, 29,6% -структуры и 60,3% неупорядоченной структуры, включая 21,7% -изгибов (табл. 10). Содержание элементов вторичной структуры PsGalА, рассчитанное с помощью серверов PSIPRED (http://bioinf.cs.ucl.ac.uk/psipred/) и SCRATCH (http://www.igb.uci.edu/tools/scratch/) на основании выведенной аминокислотной последовательности (No GenBank DQ530422.1) (табл. 10), хорошо согласуется с экспериментальными данными, полученными для нативной PsGalА из спектров КД.

Таблица Содержание элементов вторичной структуры (%) в молекуле PsGalА Неупорядоченная структура Метод расчета -спираль -структура -изгиб CONTIN/LL (190-240 нм) 19,1 29,6 21,7 29,PSIPRED 21,3 28,6 -*) 50,SCRATCH 21,1 24,5 - 54,Примечания: *) — не определяется.

1.3.6.4 Филогенетический анализ -галактозидаз Сравнительный анализ множества аминокислотных последовательностей гомологичных белков из GenBank показал, что PsGalА принадлежит к семейству GH36 и является ближайшим гомологом с -галактозидазами из морских бактерий семейства Alteromonadales TW-7 (A0XX24) идентичность — 92%) и Pseudoalteromonas atlantica (Q15PJ9) (идентичность — 51%), энзиматические свойства которых не охарактеризованы.

Для определения эволюционных взаимоотношений между белками из морских бактерий и другими представителями семейств GH27 и GH36 был проведен филогенетический анализ аминокислотных последовательностей ряда -галактозидаз. Некорневое филогенетическое древо, построенное с помощью сервера Phylogeny.fr на основании множественного выравнивания этих последовательностей представлено на рис. 11.

Исследуемые -галактозидазы разделились на два больших кластера, в которые вошли представители семейства GH27 и GH36 соответственно. GalA археи Sulfolobus solfataricus (Q97U94), обитающей в грунте геотермальных источников, находится на отдельной ветви в кластере семейства GH36, тогда как -галактозидазы термофильных бактерий Thermus sp. IB-21 (Q8GEA8), Thermus sp.

T2 (Q9WXC1) и Thermotoga maritima (O33835), изолированных из тех же источников, образовали на филограмме отдельное подсемейство в пределах семейства GH36.

Исследуемая PsGalА (Q19AX0) находится в кластере бактериальных ферментов семейства GH36, на одной ветви с -галактозидазами из морских бактерий: Pseudoalteromonas atlantica (Q15PJ9) и инвалидной бактерии семейства Alteromonadales TW-7 (A0XX24). Положение -галактозидаз морских -протеобактерий рода Pseudoalteromonas на филограмме указывает на ближайшее родство с -галактозидазами наземных мезофилов семейства Enterobacteriactae (Q2NBZ6). Из топологии полученного дерева следует, что ближайшими родственниками морских ферментов являются -галактозидазы наземных -протеобактерий Vibrio vulnificus (Q7MG03), Ervinia carotovora (Q6D965) и Escherichia coli (P16551), некоторое время сохраняющих жизнеспособность в морской водной среде.

Рис. 11. Филогенетическое древо -галактозидаз 27 и 36 семейств GH. Филограмма получена с помощью сервера Phylogeny.fr (http://www.phylogeny.fr/) с использованием программы Phylogeny PhyML 3.0 и статистического теста aLRT для аминокислотных последовательностей -галактозидаз, выровненных с помощью программы MUSCLE v3.7.

Древо построено с помощью программы TreeDyn.

1.3.6.5 Компьютерное моделирование пространственной структуры -галактозидазы и ее комплекса с -галактозой Анализ аминокислотной последовательности PsGalА с помощью сервера SWISS-MODEL показал, что в качестве прототипов для построения теоретической модели ее пространственной структуры могут быть использованы гликозидгидролазы клана-D c известной кристаллической структурой: GalA Oryza sativa семейства GH27, код PDB 1uas (OsGalA) и GalA Thermotoga maritima семейства GH36, код PDB 1zy9 (TmGalA) (рис. 12).

Q19AX0 1 MADTKSFYRL DRVNSTVIFD CQSKTPALLY FGKRLSERTT ETMLTQLATR QEVKCAVVEE APISLSPLLG O338Q19AX0 71 EGFTGAPGLE LVNDSIAWSV GPELQEVRQP SSAAVEFVSV DKLR-GIEVV HSITLDNNSD VLSAHTVLTN O33835 1 MEIFGKT FREGRFVLKE KNFTVEF-AV EKIHLGWKI- -SGRVKGSPG RLEV--LRTK * *. *..***.*.*.. *. *... *.

Q19AX0 140 LGDSPLSVNF CAAPTFQLPD SVS-KIVSFE GRWSNEFQRQ SVDLVLGSFV RENRKGKTSH DVFPGLLVHN O33835 53 APEKVLVNNW QSWGPCRVVD AFSFKPPEID PNW-----RY TASVV-PDVL ERNLQS---- DYF----VAE. * *... *. * *.. * *..*. *. * * *.

Q19AX0 209 ENAGEQHGEC YGFHLGWSGN NKLRAELLAE GRRYVQMGEL LLPGELTLAK GQTYQSPSIY GSFSSEGFSA O33835 109 E------GKV YGFL-----S SKIAHPFFA- ----VEDGEL VAYLEYFDVE FDDFVPLEPL VVLEDPNTPL * * ***..*...* *. ***. *.....

Q19AX0 279 LSRNFHRFVK ANLLSQAQRE KARPMHYNTW EGIYFDHD-V DTLKQLADKV AP-LGIERFV LEDGWFKEPS O33835 163 LLEKYAELVG ME--NNARVP KHTPTGWCSW YHYFLDLTWE ETLKNL--KL AKNFPFEVFQ IDDAYEKD-- *...*.. *. * *.*..*.*** * *. *..* *..*. *.

Q19AX0 347 WRQCRLRYWT VDYKIYPDGL SPVIDHVNSL GMEFGIWFEP EMVNPDSFLY RAHPDWVLGS ENNEQLSFRN O33835 227 -----IGDWL VTRGDFPS-V EEMAKVIAEN GFIPGIWTAP FSVSETSDVF NEHPDWVVKE NGEPKMAYRN. * *.*... * *** * *. *.. *****......** Q19AX0 417 Q----LVLDL TRSEVVEYLY KAIDDILVEY PTIKYIKWDM NRDINHAGNF DGKPAVHQQT LALYRLIDRI O33835 291 WNKKIYALDL SKDEVLNWLF DLFSSL--RK MGYRYFKIDF LFAGAVPGER –KKNITPIQA FRKGIETIR- ***.. **.. *....*.* * * *.* Q19AX0 483 KAAHPGLEIE SCSSGGARVD YGVLAHTDRV WTSDSNDALD RLEIQRGCSF FFPSSVMGAH VGPRDCHITG O33835 357 KAVGEDSFIL GCGSPLLPA- VGCVDGM-RI ----GPDTAP ---------F W------GEH I--EDNGAPA ** * * * * *..*. * * *. *.

Q19AX0 553 RNVSIEMRAA VSMFGHMGIE MDPRELNDHE YNALKAAIA- -LHKEHREFI HSA---DLYR LDSDDLSI-- O33835 404 ARWALR-NAI TRYFMH---- -DRFWLNDPD CLILREEKTD LTQKEKELYS YTCGVLDNMI IESDDLSLVR.. * * * * ***. *...**.. *..*****.

Q19AX0 616 NFGLIDAQKT KALFAYNSVR ETPRTAPNKL RF-VGLDADA QYTLNLVWPV KFEEYRPSSI AAVNGQTFTG O33835 468 DHGKKVLKET LELLGGRP-- RVQNIMSEDL RYEIVSSGTL SGNVKIVVDL NSREYHLEKE ----GKSSLK. * * *..... * *......*.. **. *.

Q19AX0 685 EALMQFGLQM PISFPQTSLI FELNKA O33835 532 KRVVKREDGR NFYFYE---- -EGERE... *. *..

Рис. 12. Выравнивание аминокислотных последовательностей PsGalА (UniProt Q19AX0) и TmGalA (UniProt O33835). На рисунке отмечены идентичные остатки (*), гомологичные замены (.), каталитические остатки (), остатки Trp190 (), Asp220 () и Cys357 (), расположенные вблизи активного центра TmGalA, и соответствующие им остатки PsGalА.

Теоретическая модель пространственной структуры PsGalА получена методом сравнительного моделирования. Для построения фрагмента структуры PsGalА в качестве прототипа использовали единственную известную кристаллическую структуру TmGalA семейства GH36. Согласно литературным данным, полипептидная цепь TmGalA состоит из 552 а.о. Выравнивание полных аминокислотных последовательностей TmGalA и PsGalА (рис. 12) выявило фрагмент полипептидной цепи (83-710 а.о.), который является общим для двух ферментов.

Степень идентичности а.о. данного фрагмента PsGalА и TmGalA составляет 19,1%, а степень гомологии фрагмента с учетом консервативных замен — 40,2%.

Как видно из рис. 12, каталитические остатки Asp327 и Asp387 TmGalA идентичны остаткам Asp451 и Asp519 PsGalА. Остатки Trp190 и Cys357 со свободной SH-группой, расположенные в полости активного центра TmGalA, идентичны остаткам Trp308 и Cys494 у PsGalА. Остаток Asp220 TmGalA консервативно заменен остатком Glu338 у PsGalА. Полученные данные указывают на сходство в строении активного центра ферментов.

Модель 3D-структуры фрагмента с 83 по 710 а.о. PsGalА построена с помощью программы МОЕ (рис. 13, А).

Рис. 13. А — Модель фрагмента пространственной структуры PsGalА с 83 по 7а.о., построенная на основе кристаллической структуры TmGalA. Структура PsGalА изображена в виде ленточной диаграммы, цветом показаны элементы вторичной структуры (-спирали — красным, -структура — желтым, -изгибы — синим, неупорядоченная структура — голубым цветом). Б — Суперпозиция структур PsGalА (красного цвета) и TmGalA (зеленого цвета). Структуры показаны в виде ленточных диаграмм.

Величина потенциальной энергии модели в вакууме составила -30769,кДж/моль. Суперпозиция С атомов модели этого фрагмента и прототипа показала, что величина среднеквадратичного отклонения составляет 1,24 . Различия наблюдаются в протяженности -спиралей и -тяжей, а также в области петель на поверхности молекул (рис.13, Б). Полипептидная цепь исследуемого фрагмента PsGalА уложена в три домена, как у прототипа. В N-концевом домене (83-295 а.о.) видны антипараллельные -тяжи, упакованные в форме -сэндвича, и несколько коротких -спиралей. Укладка центрального домена (296-576 а.о.) PsGalА в виде -цилиндра, окруженного -спиралями и неупорядоченными петлями, соответствует пространственной структуре (/)8-цилиндра ферментов семейств GH27 и GH36, который, как известно, выполняет функцию каталитического домена у всех ферментов клана GH-D. Полипептидная цепь С-концевого домена (577-7а.о.) образует -складку из антипараллельных -тяжей, меньшего размера, чем -сэндвич, т.н. "греческий ключ", ферментов семейства GH27.

Модель пространственной структуры PsGalА с учетом N-концевого участка (182 а.о.), отсутствующего в модели фрагмента, построенного с использованием программы МОЕ, получена с помощью программного обеспечения сервера I-TASSER (zhanglab.ccmb.med.umich.edu/I-TASSER/) (рис. 14). Согласно данным сервера I-TASSER структура участка полипептидной цепи с 1 по 82 а.о. содержит протяженный -спиральный фрагмент. В настоящее время отсутствуют литературные данные о пространственной упаковке N-концевого домена других гликозидгидролаз семейства GH36, кроме TmGalA. Следует отметить, что TmGalA имеет самую короткую полипептидную цепь среди ферментов семейства GH36 и не образует олигомерной структуры.

Содержание элементов вторичной структуры, рассчитанное на основании теоретических моделей и спектра КД нативной PsGalА, приведено в таблице 11.

Экспериментальные данные о вторичной структуре фермента коррелируют с данными, полученными нами с помощью теоретических моделей.

Рис. 14. Модель полной пространственной структуры PsGalА, построенная с учетом 1-а.о. с помощью сервера I-TASSER. Структура PsGalА приведена в виде ленточной диаграммы, цветом показаны элементы вторичной структуры (-спирали — красным, -структура — желтым, изгибы — синим, неупорядоченная структура — серым цветом).

Таблица Содержание элементов вторичной структуры (%) PsGalА Неупорядоченная Вид белка -спираль -структура структура Модель фрагмента 83-710,7 22,8 66,(программа МОЕ) Модель полной структуры 22,1 25,2 52,(сервер I-TASSER) Нативная PsGalА 19,1 29,6 51,(КД спектр, CONTIN/LL) Пространственную структуру каталитического домена PsGalА, который включает участок полипептидной цепи с 296 по 576 а.о., а также структуру активного центра PsGalА исследовали с использованием в качестве прототипа OsGalA семейства GH27.

Выравнивание аминокислотных последовательностей каталитических доменов -галактозидаз представлено на рис. 15.

Q19AX0 296 -------------------------------------------------------QREKA 1uas 1 ---------------------------------------------------FENG-LGRT Q19AX0 301 RPMHYNTWEGIYFDHDVDTLKQLADK-----VAPLGIERFVLEDGWFKEPSWRQCRLRYW 1uas 9 PQMGWNSWNHFYCGINEQIIRETADALVNTGLAKLGYQYVNIDDCW-AEYS-RDSQGNF- Q19AX0 356 TVDYKIYPDGLSPVIDHVNSLGMEFGIWFEPEMVNPDSFLYRAHPDWVLGSENNEQLSFR 1uas 58 VPNRQTFPSGIKALADYVHAKGLKLGIYSD------------------AGSQT---CSNK Q19AX0 416 NQLVLDLTRSEVVEYLYKAIDDILVEYPTIKYIKWDMNRDINHAGNFDGKPAVHQQTLAL 1uas 97 MPGSLDHEEQDVKTFASWGVD----------YLKYD---NCNDA----GRSVMERYT--- Q19AX0 476 YRLIDRIKAAHPGLEIESCSSGGARVDYGVLAHTDRVWTSDSNDALDRLEIQRGCSFFFP 1uas 145 -RMSNAMKTYGKNIFFSLCEWGKENPATWA-GRMGNSWRT-TGDIADNWGSM--TSRADE Q19AX0 536 SSVMGAHVGPRDCHITGRNVSIEMR 1uas 200 NDQWAAYAGP-----GGWN-DPDML Рис. 15. Выравнивание фрагментов аминокислотных последовательностей (296576 а.о.) PsGalА и (1-275 а.о.) OsGalA (UniProt Q9FXT4), соответствующих каталитическим доменам. На рисунке отмечены каталитические остатки (), остатки Trp16 () и Cys162 (), расположенные в активном центре OsGalA, и соответствующие им остатки PsGalА.

Для OsGalA семейства GH27 и PsGalА семейства GH36 в активном центре идентичными остаются остатки Asp130 и Asp451, Asp519 и Asp185, Trp16 и Trp308, Cys162 и Cys494 соответственно (рис. 15). Остаток Asp51 OsGalA заменен на Glu338 у PsGalА. Это пока единственный случай замены остатка Asp на Glu у -галактозидаз из семейств GH27 и GH36.

Исследованием кристаллической структуры комплекса OsGalA с D-галактозой установлено, что остаток Asp185 выступает в качестве сопряженной кислоты/основания, а Asp130 действует как нуклеофил. Из суперпозиции пространственных структур каталитического домена OsGalA (фрагмент 1-275 а.о.) и модели каталитического домена PsGalА (фрагмент 296-576 а.о.), построенной на основе кристаллической структуры каталитического домена OsGalA с помощью программы МОЕ (рис. 16) видно, что указанные выше остатки Asp в пространстве совместились. Это может свидетельствовать об идентичности их функции в активном центре обоих ферментов.

Рис. 16. Суперпозиция каталитического домена OsGalA (код PDB 1uas) и модели каталитического домена PsGalА, построенной на основе кристаллической структуры OsGalA. Структура доменов изображена в виде основной цепи, цветом показаны элементы вторичной структуры (-спирали — красный, -структура — желтый, изгибы — синий, неупорядоченная структура — серый). Каталитические остатки показаны в шаростержневой форме: зеленым цветом — остатки Asp130 и Asp1OsGalA, красным цветом — Asp451 и Asp519 PsGalА. На рисунке указаны расстояния между каталитическими остатками OsGalA (6,46 ) и PsGalА (5,76 ).

На рис. 16 указаны расстояния между каталитическими остатками OsGalA (6,46 ) и PsGalА (5,76 ), что соответствует расстоянию между каталитическими карбоксилами для классических гликозидгидролаз, катализирующих гидролиз Огликозидной связи с сохранением оптической конфигурации аномерного центра субстрата.

Пространственное взаиморасположение каталитических остатков (Asp451 и Asp519) и других остатков их ближайшего окружения (Trp308, Glu338 и Cys494) представлено на рис. 17. Консервативный Trp308, расположенный на расстоянии 30 а.о. от маркерного участка DD(G/C)W для гликозидгидролаз семейства GH(рис. 12), соответствует Trp16 у OsGalA (рис. 15). Согласно литературным данным, Trp16 вносит существенный вклад в создание гидрофобного микроклимата в этом районе молекулы, необходимого для протонирования каталитических остатков Asp.

Функциональная важность остатка Trp для PsGalА, вытекающая из модели пространственной структуры, согласуется с экспериментальными данными, полученными нами методом ингибиторного анализа (табл. 9).

Рис. 17. Структура фрагмента активного Рис. 18. Сайт связывания -галактозы с центра -галактозидазы Pseudoalteromonas -галактозидазой Pseudoalteromonas sp.

sp. КММ 701. Аминокислотные остатки КММ 701. Пунктиром показаны показаны в стержневой форме. На рисунке водородные связи, образованные приведены каталитические остатки (Asp451 -галактозой: Glu338.OE1-Gal.O4, и Asp519) и функционально важные остатки Asp451.OD1-Gal.O6, Asp519.OD1-Gal.O1, их ближайшего окружения (Trp308, Glu338 и Asp519.OD1-Gal.O2.

Cys494).

Методом молекулярного докинга построена теоретическая модель структуры комплекса PsGalА с молекулой D-Gal (рис. 18). Установлено, что конкурентный ингибитор D-Gal взаимодействует с активным центром фермента, образуя водородные связи: Glu338.OE1-Gal.O4, Asp451.OD1-Gal.O6, Asp519.OD1-Gal.O1, Asp519.OD1-Gal.O2, три из которых — с каталитическими остатками Asp451 и Asp519. Величина свободной энергии связывания галактозы с каталитическим доменом фермента составила -11,916 ккал/моль. Теоретическая константа ингибирования фермента галактозой (pKi), рассчитанная с помощью модуля LigX программы МОЕ составила 9,01 мкМ.

Таким образом, в результате выполненного нами анализа моделей пространственных структур показана идентичность каталитических а.о. у ферментов семейств GH27 и GH36. В активном центре PsGalА роль сопряженной кислоты/основания выполняет Asp451, а нуклеофила — Asp519. При низкой идентичности аминокислотных последовательностей гликозидгидролазы семейств GH27 и GH36 имеют высокую степень гомологии как пространственных структур в целом, так их каталитических доменов и активных центров, что позволяет ферментам реализовывать одинаковый механизм катализа. Данное исследование еще раз подтвердило, что -галактозидазы семейств GH27 и GH36 имеют общее происхождение и механизм действия. Полученную модель пространственной структуры PsGalА можно использовать в дальнейших исследованиях взаимосвязи структуры и функции фермента.

1.3.8 Иммобилизация -галактозидазы в гибридных нанокомпозитах, содержащих полисахариды Иммобилизация ферментов давно и успешно используется на практике.

Включение в матрицу или закрепление на носителе позволяет многократно использовать ферменты и облегчает отделение продуктов ферментативной реакции, что имеет существенное значение при создании биотехнологических процессов. Иммобилизация значительно увеличивает время функционирования и устойчивость ферментов.

При иммобилизации по методу золь-гель технологии макромолекулы белка включаются в неорганическую матрицу, формирующуюся in situ в результате реакций поликонденсации. При этом они претерпевают минимальные изменения пространственной структруры, что обеспечивает сохранение активности ферментов.

Иммобилизация PsGalА выполнена в гибридных полисахарид-силикатных нанокомпозитных материалах, синтезированных в Институте химии ДВО РАН с использованием нового прекурсора — тетракис(2-гидроксиэтил)ортосиликата (ТГЭОС). К числу достоинств прекурсора относятся растворимость в воде и совместимость с биополимерами. Полисахариды являются катализаторами зольгель процессов. В их присутствии гелеобразование протекает при любых значениях рН, а также при низких температурах, что важно для термолабильных ферментов.

Чтобы минимизировать денатурацию термолабильной PsGalА в процессе включения в силикатную матрицу, иммобилизацию проводили при температуре, близкой к 0°С и рН 7,2.

Активность PsGalА, иммобилизованной в различных по составу гибридных полисахарид-силикатных нанокомпозитных материалах, тестировали на протяжении 16 мес. (табл. 12).

Таблица Активность -галактозидазы в зависимости от условий её иммобилизации и времени хранения Время хранения, сутки № SiO2, Полисахарид, мас% 0 6 19 30 43 165 4геля мас% mU/г геля 1 0 Свободная PsGalA * 33,6 21,8 16,5 н.о. ** 18,7 0 2 10 ЛБГ, 0,25 34,6 50,9 76,8 н.о. 54,1 н.о. 28,3 10 ЛБГ, 0,75 32,8 56,7 81,8 н.о. 63,5 н.о. н.о.

4 10 ЛБГ, 1,5 9,2 10,9 12,0 н.о. 8,4 н.о. 9,5 10 ксантан, 0,25 63,9 н.о. н.о. 21,7 н.о. н.о. н.о.

6 30 ксантан, 0,25 14,1 н.о. н.о. 0,1 н.о. н.о. н.о.

7 10 ламинаран, 0,35 20,0 н.о. н.о. 0 н.о. н.о. н.о.

8 10 Сat-HEC 0 н.о. н.о. н.о. н.о. н.о. н.о.

* — mU/мл, **н.о. — не определяли Наибольшая активность фермента наблюдалась у образца №5.

Ферментативная активность образцов №2 и №3, содержащих полисахарид, являющийся высокоразветвленным галактоманнаном (ЛБГ), сразу после иммобилизации была сопоставима по уровню с активностью фермента в растворе.

При увеличении количества силиката и ЛБГ (образцы №3 и №4) активность значительно снижалась. В ряду исследованных полисахаридов только присутствие ламинарана в геле не оказывало стабилизирующего действия на иммобилизованную PsGalА.

Большое значение для практического применения иммобилизованных ферментов имеет удерживание их в/на носителе. После двух суток выдерживания гелей в буферном растворе при 4°С их подвергали центрифугированию и определяли активность фермента в супернатантах и в гелях. Ферментативная активность практически полностью отсутствовала в растворах, в которых выдерживались биокатализаторы (табл. 13). Это указывает на достаточно хорошее закрепление макромолекул фермента в матрице геля. Однако активность фермента в самих гелях №2 и №3 оказалась значительно ниже исходной.

Возможно, центрифугирование привело к уплотнению гелей, что стало причиной либо ограничения доступа субстрата к ферменту, либо инактивации иммобилизованного фермента. Любопытно отметить, что с увеличением концентрации ЛБГ в геле (образец №4) механическое воздействие отразилось на активности фермента в значительно меньшей степени (табл. 13).

Таблица Удерживание -галактозидазы в силикатном нанокомпозите с различным содержанием ЛБГ mU № ЛБГ, мас% mU/г геля в 1 мл геля в 1 г геля супернатанта 2 0,25 34,6 0,076 3,3 0,75 32,8 0,018 12,4 1,50 9,2 0,009 12,Включение PsGalА в силикатную матрицу привело к некоторому уширению интервала рН, но практически не изменило величины рН-оптимума фермента.

Возросла термостабильность PsGalА, каталитические характеристики фермента существенно не изменились.

Таким образом, матрицы, содержащие нейтральный полисахарид ЛБГ, являются оптимальными для иммобилизации PsGalА.

1.3.9 Влияние природных и синтетических полигидрокси-1,4-нафтохинонов на активность -галактозидазы Исследовано влияние морских природных полигидрокси-1,4-нафтохинонов (ПГНХ) и их синтетических производных (рис. 19) на гидролитическую активность PsGalА.

R5 O RRR3 ROH O Рис. 19. Соединения, использованные в качестве эффекторов PsGalА. R1, R2, R3, R4, R5 – см. в таблице 14.

Результаты выполненного исследования (табл. 14) позволили разделить эти соединения на три группы: I — -метоксипроизводные 5,8-дигидрокси-1,4нафтохинонов (1 — 6), не влияющие на активность PsGalА в концентрациях 3,2 — 4,610-4 M в условиях эксперимента; II — соединения (7 — 16), подавляющие активность фермента на 50% при концентрациях C50 10-4-10-5 M; III — полигалогензамещенные нафтазарины (17 — 21), наиболее эффективно ингибирующие фермент (C50 10-6 M).

Все соединения со свободными -ОН группами либо не ингибируют фермент, как эхинохром А (2), либо проявляют ингибирующее действие при достаточно высоких концентрациях, как соединение 16 (C50 = 2,3·10-5 M). В водных растворах при физиологических значениях рН О-Н связь -гидроксильных групп этих соединений подвергается гетеролитической диссоциации с образованием моно- или дианионов. Эхинохром А (2) при рН 7,3 существует в виде дианиона. По отсутствию ингибирующего действия эхинохрома А (2) можно предположить, что область активного центра PsGalА при рН 7,3 электростатически отрицательна и ее заряд может препятствовать связыванию этого соединения.

Таблица Влияние природных и синтетических полигидрокси-1,4-нафтохинонов на активность -галактозидазы Заместитель №*) Происхождение Mr C 104, M R1 R2 R3 R4 RОтсутствие эффекта ингибирования 1 C2H5 H H H OH синтетический 218,2 4,2 OH OH OH C2H5 OH природный 266,2 3,3 OCH3 C2H5 C2H5 OCH3 OH синтетический 306,3 3,4 Cl OCH3 OCH3 C2H5 OH синтетический 312,7 3,5 Cl OCH3 C2H5 OCH3 OH синтетический 312,7 3,6 OCH3 OCH3 OCH3 C2H5 OH синтетический 308,3 3,Снижение активности фермента на 50%**) 7 OH OH H OH H природный 222,2 4,8 OH H Cl Cl OH синтетический 275,0 4,3±1,9 OH C2H5 OH OH H природный 250,2 4,10 OH C2H5 OH C2H5 OH природный 278,3 3,11 OH C2H5 C2H5 OH OH природный 278,3 2,12 Cl Cl C2H5 H OH синтетический 287,1 2,0±1,13 OH C2H5 Cl Cl H синтетический 303,1 1,14 OH C2H5 H OH OH природный 250,2 1,15 H H H H OH коммерческий 190,2 0,16 C2H5 OH OH OH H природный 250,2 0,17 Cl Cl OCH3 C2H5 OH синтетический 317,1 0,018 Cl Cl H H OH синтетический 259,1 0,039±0,019 Cl Cl Cl C2H5 OH синтетический 321,5 0,029±0,020 Cl Cl Br H OH синтетический 337,9 0,021 Cl Cl Cl H OH синтетический 293,6 0,016±0,0Примечания: *) — номер соединения; **) — в таблице приведенгы концентрации соединений, при которой активность фермента снижалась на 50% при выдерживании фермента в присутствии этого соединения в течение 30 мин.

Исследуемые соединения различаются действием на фермент, которое зависит от природы заместителя и его расположения в кольцах. Локализация гидроксильной и этильной групп в положениях 2 и 3 хиноидного кольца влияет на ингибирующее действие соединения (см. данные для изомеров 9 и 16). Вероятно, одна из ОН-групп в положениях 6 и 7 соединения 16 более кислая и поэтому легче, чем в случае соединения 9, вступает в образование межмолекулярной водородной связи с нуклеофильными группами активного центра фермента. Причиной этого различия может быть также стерический фактор и/или возникновение дополнительной водородной связи за счет ОН-группы в 5-м положении бензоидного кольца. Так, при одинаковом характере связывания всей молекулы ингибитора эта гидроксильная группа для соединений 9 и 16 должна будет попадать в разные участки активного центра.

Показано, что ингибирование ПГНХ обратимо. Галогензамещенный нафтазарин 19 необратимо ингибирует, т.е. инактивирует фермент: после гельфильтрации фермента, инактивированного соединением 19, его активность не восстанавливалась. Эффективными необратимыми ингибиторами оказались соединения 17 — 21 (табл. 14, рис. 19). PsGalА имеет функционально значимую(ые) SH-группу(ы) (табл. 9, рис. 17, 18). Механизм влияния нафтохинонов на активность некоторых ферментов, содержащих свободные SH-группы остатков Cys, обсуждался в литературе. В результате сопряженного присоединения (реакции Михаэля) S-нуклеофила образуется ковалентно связанный коньюгат нафтазарина с ферментом. Возможность протекания реакций такого типа в мягких условиях показана ранее на примере реакции 2,3-дихлорзамещенного нафтазарина 17 и восстановленной формы трипептида глутатиона.

Электронодонорные заместители в хиноидном кольце нафтазарина понижают способность его к сопряженному присоединению нуклеофилов, что видно из сопоставления эффектов соединений 15 и 1, 18 и 12. Соединения 17 — 21, имеющие электроноакцепторные заместители в хиноидном ядре, проявляют себя как эффективные необратимые ингибиторы фермента за счет активации положений 2 и 3 хиноидного кольца к атаке нуклеофилов. Присутствие электронодонорных заместителей Еt или Me в бензоидном кольце этих соединений также вызывает понижение, а присутствие электроноакцепторных заместителей Br или Cl — повышение их инактивирующей способности.

Низкую ингибирующую способность соединения 8, также содержащего два атома хлора в одном кольце нафтазаринового кора, можно объяснить существованием его в экспериментальных условиях в виде моноаниона, являющегося энергетически наиболее выгодной таутомерной формой этой молекулы. Атомы хлора в моноанионе 8 локализованы в бензоидном ядре, где они не могут вступать в реакции нуклеофильного замещения RS-функции по механизму сопряженного присоединения тиола и последующего отщепления молекулы НСl.

То же самое относится и к соединению 13. Отсутствие инактивирующего действия у хлорзамещенных нафтазаринов 4 и 5 можно объяснить соседством с атомом хлора сильной электроноакцепторной МеО-группы, нивелирующей активирующее влияние атома хлора для атаки нуклеофила в положения 2 и 3 хиноидного кольца.

Сайт связывания ингибитора 15 в активном центре PsGalА показан на рис. (А). Как видно из рисунка, соединение 15 локализовано в непосредственной близости от каталитических остатков Asp451, Asp519, в окружении остатков Trp308, Cys494 и Ser496.

Б А Рис. 20. А — сайт связывания нафтазарина 15 в активном центре PsGalА. Красным цветом показана область активного центра фермента, несущая отрицательный электростатический заряд, синим цветом — положительный, серым цветом — нейтральный. Б — локализация соединения 21 в активном центре вблизи свободной сульфгидрильной группы Cys494. Аминокислотные остатки соединения 15 и показаны в стержневой форме. Свободная сульфгидрильная группа окрашена в желтый цвет, атомы хлора — в зеленый цвет.

Внутренняя поверхность активного центра электростатически отрицательна.

-Гидроксильная группа соединения 15 образует водородную связь с карбонилом Asp519, а противоположный карбонил в положении С5 хиноидного кольца — с ОНгруппой остатка Ser496. Локализация наиболее эффективного необратимого ингибитора 21 в активном центре PsGalА показана на рис. 20 (Б). Свободная SH-группа остатка Cys494 приближена к С3 хиноидного кольца трихлорнафтазарина на расстояние 3,15 , что создает предпосылку к реакции нуклеофильного замещения атома Cl. Образование ковалентной связи между Cys494 и соединением 21, вероятно, является причиной необратимого ингибирования фермента под действием данного соединения. Интересно отметить, что наиболее цитотоксичные соединения 19, 20 и 21 для развивающихся эмбрионов морского ежа Strongylocentrotus intermedius, оказались и самыми эффективными необратимыми ингибиторами фермента.

Таким образом, показано, что ингибирующие свойства ПГНХ по отношению к PsGalА зависят от природы заместителей, их числа и положения в структуре соединений. Благодаря высокой чувствительности к характеру и расположению заместителей, фермент можно рассматривать как тест-систему для получения аналитической информации, касающейся обнаружения и оценки высокотоксичных хлорпроизводных нафтазарина, являющихся микропримесями в препаратах синтетического эхинохрома А.

2. Фукоиданазы морских бактерий Другой группой морских ферментов, исследованных в представленной работе, являются фукоиданазы (ЕС 3.2.1.-), О-гликозидгидролазы, катализирующие гидролиз -гликозидной связи между остатками L-фукозы в основной цепи фукоиданов. В настоящее время сведения о фукоиданазах в литературе крайне ограничены. Недавно появились сообщения об аминокислотных последовательностях трех бактериальных фукоиданаз, на основании которых эти ферменты объединены в особое семейство GH107. Это — внутри- и внеклеточные фукоиданазы из Alteromonas sp. SN-1009 (No GenBank AAO00508.1 и AAO00509.соответственно) и внеклеточная фукоиданаза из Mariniflexile fucanivorans SW5 (No GenBank CAI47003.1). Механизм гидролитического действия и пространственные структуры этих ферментов не охарактеризованы, номенклатурный номер ферментам не присвоен.

2.1 Выделение фукоидана из природного комплекса с полифенолами Для поиска, изучения свойств и субстратной специфичности фукоиданаз необходимы высокоочищенные образцы полисахаридов с установленной структурой. Сотрудниками лаборатории химии ферментов ТИБОХ разработан метод получения фукоидана из различных бурых водорослей. Выход фукоидана при переработке водоросли F. evanescens достигает 15% от сухой массы. Однако образцы этого полисахарида (F0) сохраняют бурую окраску и обладают высокой восстанавливающей способностью.

УФ-спектр поглощения образца фукоидана F0 свидетельствует о присутствии в нем соединений с высокосопряженной ароматической структурой (рис. 21, 1).

Согласно литературным данным бурые водоросли могут накапливать до 14% полифенольных соединений от массы сухой водоросли, главным образом, флороглюцина (1,3,5-тригидроксибензола) и его полимеров — флоротаннинов.

Рис. 21. УФ-спектр поглощения (1), возбуждения (2) и флуоресценции (возб — 366 нм) (3) фукоидана F0 из бурой водоросли F. evanescens (1 мг/мл, 0,1 М Na+-фосфатный буфер, рН 8,4).

Присутствие этих соединений в образцах полисахарида затрудняет тестирование активности фукоиданаз по увеличению восстанавливающей способности сахаров. Влияние свободных и связанных с полисахаридами полифенолов на активность фукоиданаз также не исследовалось. Поэтому крайне важно для изучения этих ферментов использовать субстрат, не содержащий полифенольных соединений.

Флоротаннины являются флуоресцирующими соединениями. Спектры флуоресценции (СФ) полифенолов, связанных с фукоиданами, прежде не исследовались. Широкий максимум СФ образца F0 (рис. 21 (2, 3)) расположен при 450-460 нм. Значение индекса флуоресценции (I = f450/f500), характеризующего форму СФ, составляет 1,15. На флуоресценцию связанных флоротаннинов могут влиять различные факторы микроокружения, в том числе природа и состояние ионогенных групп полисахарида. Так, согласно литературным данным, СФ полифенолов, связанных с альгиновой кислотой из бурой водоросли Laminaria pallida и коммерческим альгинатом Manugel GHB, характеризуются максимумом при 440-445 нм и величиной I = 1,96.

Известно, что полифенолы, прочно ассоциированные с полисахаридами, особенно альгиновыми кислотами и фукоиданами, могут связывать между собой несколько молекул различных полисахаридов или, как сеть, опутывать их. Природа таких взаимодействий не изучена.

Для освобождения фукоидана от полифенольных соединений в данной работе использовали перекись водорода, которая широко применяется для обесцвечивания природных полисахаридов. Степень очистки образцов полисахарида контролировали флуориметрическим методом, который относительно прост для выполнения, чувствителен, удобен для определения относительного содержания флуоресцирующих примесей в образце и позволяет быстро сделать заключение об эффективности различных стадий очистки полисахарида.

После обработки исходного полисахарида F0 5%-ным водным раствором перекиси водорода при рН 8,5 получили образец полисахарида F, который разделили с помощью DEAE-целлюлозы в линейном градиенте H2О/NaCl (0-2 M) на две фракции F1 и F2. Оба образца полисахарида по данным метода флуоресценции были практически полностью очищены от полифенольных соединений. Молекулярная масса полисахарида F2 составила 40-60 кДа.

Полисахарид F1 (табл. 15), согласно С ЯМР-спектру, оказался альгиновой кислотой, состоящей в основном из остатков D-маннуроновой кислоты (МММ), с небольшим включением остатков L-гулуроновой кислоты (GGM-блоков).

Таблица Характеристика полученных образцов полисахаридов Состав нейтральных Общий Восст.

Обра- Выход, -SO3-, []D20 °, моносахаридов,% сахар, способ, зец %*) %***) Н2О % %**) Fuc Rha Gal Glc Xyl F0 100 46 100,0 14,3 -114,8 69,0 3,3 5,2 11,8 10,F 60 49 7,1 16,8 -124,2 74,2 0 9,0 0 16,F1 8 48 11,0 0 -90,0 0 0 0 0 F2 38 40 0,2 31,4 -173,0 94,6 0,3 4,2 0 0,Примечания: *) — % от навески исходного полисахарида F0; **) — % относительно восстанавливающей способности исходного образца фукоидана F0; ***) — количество сульфатных групп определено турбидиметрическим методом и представлено как % от навески вещества.

Полисахарид F2 (табл. 15) имел 13С ЯМР-спектр, характерный для фукоидана, сульфатированного преимущественно по С2, с невысокой степенью ацетилирования. Фукоидану соответствовали сигналы в области высокого поля с 16,9-18,06 м.д., сигналы в области аномерного атома углерода с 100,2, 99,95, 98,36, 94,96 м.д. и сигналы в области 75-83,7 м.д., а также сигналы углерода ацетатных групп в области 21-22 м.д. Согласно литературным данным, С ЯМР-пектр свидетельствовал о наличии в структуре полисахарида Fфрагментов (1,4)--LFucp2SO3-, (1,3)--L-Fucp2,4SO3-, (1,3)--L-Fucp2SO3- (Bilan M.I., et al., 2002).

ИК-спектры полисахаридов F0 и F2 оказались идентичными. Отношение поглощения сульфатных групп и скелетного колебания сахарного кольца при 12и 1022 см-1 (0,90 и 0,88) совпадало в пределах ошибки ± 4%. В ИК-спектрах этих образцов также наблюдались полосы поглощения при 823 и 827 см-соответственно. Математический анализ контура этих полос с разложением на составляющие компоненты показал, что полоса при 823 см-1 в спектре исходного образца F0 состоит из двух компонент, с частотами при 848 и 819 см-1, а компоненты полосы при 827 см-1 в спектре образца полисахарида F2 имеют максимумы при 844 и 820 см-1, которые характерны для сульфатных групп в положении С4 и С2 фукопиранозы соответственно. Отношения площадей этих компонент для двух образцов (0,84 и 0,78 соответственно) отличались лишь на 7%.

Превалирование компоненты при 819-820 см-1 свидетельствует о преобладании в исходном и очищенном образцах фукоидана экваториальных сульфатных групп при С2.

Таким образом, в результате проделанной работы получен образец фукоидана F2, свободный от полифенольных соединений и примеси альгиновых кислот, практически не имеющий восстанавливающей способности. Фукоидан Fимел молекулярную массу 40-60 кДа и структуру полисахаридной цепи, согласно спектральным данным, характерную для фукоидана из бурой водоросли F. evanescens.

2.1.1 Исследование биологической активности фукоидана из F. evanescens, освобожденного от недиализуемых полифенолов Было выполнено сравнительное исследование биологического действия полисахарида F2, освобожденного от недиализуемых полифенолов, и образца фукоидана, связанного с полифенолами (F0).

На модели развивающихся эмбрионов морского ежа Strongylocentrotus intermedius оба образца фукоидана показали отсутствие токсичности для эмбрионов, а также аномалий их развития в диапазоне испытанных концентраций от 10 до 1000 мкг/мл. Оба образца, добавленные как сразу после оплодотворения, так и на стадии "зигота", практически в 1,5 — 2 раза увеличивали продолжительность жизни эмбрионов относительно контрольного эксперимента.

Нейтрофилы используют в качестве модели in vitro для изучения иммуномодулирующего действия веществ. Действие образцов фукоиданов F0 и Fна функциональную активность нейтрофилов исследовали по активности их кислородозависимых микробицидных систем в спонтанном тесте с нитросиним тетразолием (НСТ-тест), а также по их способности к адгезии на пластик (табл. 16).

Оба образца полисахарида проявляли одинаковую активность в НСТ-тесте, однако в присутствии фукоидана F2 отмечена более высокая адгезивная активность нейтрофилов по сравнению с исходным образцом F0, что может быть следствием экранирующего эффекта полифенолов для проявления фукоиданом из F. еvanescens мембранотропной активности.

Антикоагулянтную активность образцов фукоидана F0 и F2 изучали с использованием стандартных методик (табл. 17). Ингибирование тромбина и фактора Ха наблюдали по времени свертывания плазмы крови кроликов в тестах АЧТВ (активированное частичное тромбопластиновое время) и "РеаКлот" с увеличением концентрации полисахаридов.

Таблица Влияние образцов фукоидана на показатели НСТ-теста и адгезивной активности нейтрофильных лейкоцитов Концентрация Индекс стимуляции полисахарида, показателя НСТ-теста адгезивной активности мкг/мл F0 F2 F0 F10 1,02 1,12 1,21 1,50 1,12 1,21 1,33 1,100 1,23 1,29 1,49 2,Влияние исследуемых препаратов на появление сгустка плазмы оценивали по концентрации, при которой время свертывания плазмы увеличивалось в 2 раза по сравнению с контрольным экспериментом. F0 эффективнее ингибировал появление сгустка плазмы, чем F2 (контрольное время 2АЧТВ — 18,3±0,6 сек;

табл. 17).

Таблица Антикоагулянтная активность фукоиданов Коагулологические определения с плазмой кроликов / человека Образец 2АЧТВ, мкг/мл 2РеаКлот, мкг/мл aIIa, ЕД/мг аХа, ЕД/мг F0,6±0,05/ 1,8±0,5/ 60±11/ 36,5±4/ F13,5±1,3*)/ 11,0±1*)/ 12±5*)/ 20,3±3*)/ НФГ 203,0,5±0,03/0,6±0,НМГ 10,43±0,1/0,8±0,Примечания: НФГ — нефракционированный гепарин; НМГ — низкомолекулярный гепарин;

*) — достоверность различий с показаниями исходного фукоидана (p<0,05); n = (3-5).

Специфические аIIа-активности образцов (стандарт — гепарин) в тесте АЧТВ были в 5 раз выше для образца F0. Полисахарид F0 обладал способностью ингибировать появление сгустка плазмы в тесте "РеаКлот" в большей степени, чем образец F2 (контрольное время 2РеаКлот 30,8±0,7 сек; табл. 17). В тесте РеаКлот специфические аXа активности были также выше для F0 (табл. 17). Видно, что очистка от полифенолов снижает антикоагулянтную и специфические активности фукоидана.

При проведении биоспецифического электрофореза НФГ, исходного фукоидана F0 и образца F2, освобождённого от полифенолов, с классическим антидотом для гепаринов — сульфатом протамина, отмечено образование комплексов для всех образцов. На основании анализа результатов электофореза установлено, что очистка фукоидана из F. evanescens от полифенолов приводит к незначительному снижению его способности ингибировать как тромбин, так и фактор Ха.

Таким образом, при полном отсутствии цитотоксической активности, образцы фукоиданов, освобожденные от полифенолов, сохраняют биологические свойства, характерные для природного комплекса полисахарида с полифенолами.

Высокоочищенный образец фукоидана можно использовать в качестве субстрата для поиска и изучения свойств фукоиданаз.

2.2 Распространение фукоиданаз среди бактерий-эпифитов бурых водорослей и ассоциантов голотурии Распространение фукоиданаз было исследовано среди 25 штаммов гетеротрофных бактерий, изолированных из бурых водорослей семейства фукусовых парамуширской популяции, и среди 54 штаммов бактерий, выделенных из целомической жидкости и гомогенатов голотурии, обитающей в заливе Петра Великого Японского моря (табл. 18). В качестве субстратов для тестирования активности ферментов, деградирующих фукоидан, использовали два структурноразличающихся полисахарида: 1,3;1,4--L-фукан из F. evanescens (F2), сульфатированный по положению C2 остатка фукопиранозы, и 1,3--L-фукан из L.

cichorioides (FL), сульфатированный практически полностью (по положениям С2 и С4).

Большая часть исследованных изолятов (96%) являлась грамотрицательными аэробными палочками, доминирующими среди бактерий, обитающих в морской среде. Фукоиданазная активность отмечена в 14 (56%) из 25 исследованных экстрактов бактерий-эпифитов (табл. 18). Экстракты 10-ти штаммов действовали на оба фукоидана F2 и FL, экстракты четырех — только на полисахарид FL.

Среди 54 бактериальных изолятов голотурии A. japonicus фукоиданазная активность была обнаружена у 37 (68,5%) штаммов. В этой группе бактерий обнаружены два изолята, экстракты которых деградировали фукоидан F2 и не действовали на фукоидан FL (табл. 18).

В итоге на способность к деградации фукоиданов было проверено бактериальных штаммов, из них 51 изолят (64,6%) имел в составе ферментных систем фукоиданазы. Все бактерии-эпифиты группы Flexibacter/Cytophaga оказались продуцентами фукоиданаз. Следующими по количеству продуцентов фукоиданаз были эпифиты группы родов Alteromonas/Pseudoalteromonas. Среди изолятов голотурии встречались продуценты фукоиданаз, принадлежащие к роду Vibrio, Micrococcus, Pseudomonas/Halomonas, а также коринеподобных бактерий.

Бактерии родов Alteromonas/Pseudoalteromonas зарекомендовали себя лучшими продуцентами фукоиданаз. Однако необходимо отметить, что уровень активности фукоиданаз по сравнению с другими гликозидгидролазами, как правило, является низким. В штаммах бактерий родов Vibrio и Micrococcus подобные ферменты обнаружены не были. Высокое содержание бактерий, имеющих фукоидандеградирующие ферменты, изолированных из бурых водорослей и голотурии, возможно, указывает на важность этих ферментов в метаболизме полисахаридов хозяина с точки зрения потребностей ассоциантов макрогидробионтов. Это может быть одним из звеньев адаптационного механизма морских микроорганизмов, колонизирующих как водоросли, так и животных, к среде обитания, посредством которого они могут использовать фукоиданы в качестве одного из источников углерода, серы и энергии.

Таким образом, показано, что фукоиданазы широко распространены среди облигатно морских аэробных бактерий-эпифитов бурых водорослей и ассоциантов голотурии, матрикс клеточных стенок которых содержит -L-фуканы.

2.2.1 Особенности состава О-гликозидгидролаз бактерий Pseudoalteromonas citrea Для дальнейшего исследования из большого числа штаммов морских бактерий КММ, способных деполимеризовать фукоиданы, были выбраны штаммы под номерами КММ 3296, КММ 3297 и КММ 3298 (табл. 18), идентифицированные как Pseudoalteromonas citrea.

На содержание фукоиданаз и других гликозидгидролаз были исследованы типовой штамм и еще 8 штаммов бактерии P. citrea из КММ ТИБОХ, выделенных из различных морских объектов. Все штаммы P. citrea, независимо от местообитания, гидролизовали ламинаран (табл. 19). Известно, что высокоактивные ламинараназы (-1,3-глюканазы) присутствуют в подавляющем большинстве морских как макро-, так и микроорганизмов. Менее эффективно экстракты изучаемых бактерий деградировали альгиновую кислоту, растворимую агарозу, КМ-целлюлозу.

Таблица Фукоидангидролазная активность*) штаммов морских бактерий, выделенных из бурой водоросли Fucus evanescens и голотурии Apostichopus japonicas Рабочий номер Фукоидан Рабочий номер Фукоидан Таксономическое положение Таксономическое положение штамма F2 FL штамма F2 FL Бурая водоросль Fucus evanescens Голотурия Apostichopus japonicus Cytophaga sp. 2F7 0 4000 Alteromonas/Pseudoalteromonas M-3HL-21/1 220 Cytophaga sp. 2F9B 660 4980 Bacillus sp. M-3HL-1/2 5790 23Cytophaga sp. 2F13 1140 12550 Коринеформы M-3HB-14/2 370 22Cytophaga sp. 2F16 600 4120 Коринеформы M-3HB-25/2 930 21Cytophaga sp. 12F2 0 6220 Коринеформы M-3HB-27/1 2010 15Cytophaga sp. 12F9 0 8590 Коринеформы M-3HB-27/2 0 8Flexibacter / Cytophaga 12F8 3920 9650 Коринеформы M-3HL-5/2 1520 Pseudoalteromonas sp. 2F10 710 12090 Cytophaga sp. M-3HB-28/1 170 1Pseudoalteromonas sp. 12F1 220 8600 Flavobacterium sp. M-3HB-26 0 10Pseudoalteromonas sp. 12F3 370 8680 Halomonas sp. M-3HL-13/2 990 6Pseudoalteromonas sp. 1F5 1490 19650 Halomonas sp. M-3HL-17/3 330 9Pseudoalteromonas sp. 20-92**) 5290 3640 Pseudoalteromonas sp. M-3HB-2****) 2230 14Pseudoalteromonas sp. 20-101-1***) 2130 2630 Pseudomonas/Halomonas M-3HB-14/1 1230 49Pseudomonas/Halomonas M-3HB-15/2 0 13Голотурия Apostichopus japonicus Pseudomonas sp. M-3HL-7/1 3060 23Acinetobacter sp. M-3HL-8/1 0 240 Pseudomonas sp. M-3HL-9 1470 6Alteromonas /Pseudoalteromonas M-3HB-8/1 1150 230 Micrococus sp. M-3HB-15/1 720 19Alteromonas / Pseudoalteromonas M-3HB-8/2 0 1270 Micrococus sp. M-3HB-25/3 0 15Alteromonas / Pseudoalteromonas M-3HB-9 420 2940 Vibrio sp. M-3HB-3 450 12Alteromonas / Pseudoalteromonas M-3HB-15/3 1540 5300 Vibrio sp. M-3HB-11/2 970 17Alteromonas / Pseudoalteromonas M-3HB-17/1 330 1260 Vibrio sp. M-3HL-6/3 0 1Alteromonas / Pseudoalteromonas M-3HB-18 1010 3150 Н.И. M-3HL-2 3360 39Alteromonas / Pseudoalteromonas M-3HB-19 0 1530 Н.И. M-3HL-7/2 3350 3Alteromonas / Pseudoalteromonas M-3HL-6/2 3180 1060 Н.И. M-3HB-15/4 660 9Alteromonas / Pseudoalteromonas M-3HL-14/2 2420 0 Н.И. M-3HB-16/1 0 3Alteromonas / Pseudoalteromonas M-3HL-14/3 1520 450 Н.И. M-3HB-16/2 440 6Alteromonas / Pseudoalteromonas M-3HL-18/1 0 20Примечания: *) — Количество единиц активности фукоиданазы (U) рассчитывали на 1 г сырой биомассы бактерии. За 1 U принимали количество фермента, при действии которого образуется 1 нмоль восстанавливающих сахаров (в пересчете на фукозу) за 20 ч, **) — КММ 3296, ***) — КММ 32(штамм выделен из бурой водоросли Chorda filum), ****) — КММ 3297.

Таблица Активность О-гликозидгидролаз штаммов Pseudoalteromonas citrea, выделенных из различных местообитаний, нм/ч/г биомассы Командор Средизем Курильские ские ное море, острова, Охотское острова, Акватория Залив Петра Великого, Японское море, Россия Франция море, Россия Берингово море, Россия Моллюски Асцидии Голоту Бурые водоросли Губка рия Морская Источники выделения Patinopecten yessoensis C. H. aurantium A. Apostic Fucus Chorda Plocamia вода grayanus transluci hopus evanesc filum sp.

dum japo- ens nicus Шифр штамма АТСС КММ КММ КММ КММ 188 КММ КММ КММ КММ КММ КММ КММ Субстрат 29719T 157 280 327 216 250 256 3297 3296 3298 5Фукоидан из F. evanescens 0 0 0 0 0 0 0 0 350 1920 960 Фукоидан из L. cichorioides 0 0 0 0 0 0 0 0 470 1300 980 Альгиновая кислота 1370 680 500 980 1190 3320 0 0 1700 1720 190 Амилоза 350 1230 910 1640 400 6270 0 470 3340 3690 3210 Ламинаран 5650 2140 1750 4220 2520 9170 3370 4140 6780 32190 5780 18Пустулан 1680 0 0 0 560 3950 0 80 0 670 610 Агароза растворимая 770 970 810 580 210 3490 10 290 1700 950 2120 37КМ-целлюлоза 1690 1880 520 1050 230 2620 0 50 1420 1890 2350 0 0 0 0 35100 3800 20000 8270 2020 1570 1750 41Np--D-Галактопиранозид 4 660 0 40 300 1560 150 1200 100 130 10 15Np--D-Глюкопиранозид 0 8 0 0 300 300 230 120 390 90 50 3Np--D-Галактопиранозид 44000 2206 8650 2070 130 4 0 80 2 0 0 Np--D-NАцетилглюкозаминид 3 0 0 0 0 0 0 0 0 0 0 Np--D-Маннопиранозид 0 0 0 0 3 0 0 0 0 0 2 Np--D-Ксилопиранозид 0 50 3 0 0 0 0 0 0 0 0 Np--Фукопиранозид Np-Сульфат 0 90 1450 340 0 0 0 0 0 0 0 Штаммы P. citrea близки по гликаназному составу, но осуществлять деградацию фукоиданов могли только три из них — КММ 3296, КММ 3298, КММ 3297. Эти штаммы были выделены из бурых водорослей и голотурии, богатых -L-фуканами, в отличие от остальных девяти, местообитания которых не связаны напрямую с наличием этих полисахаридов.

По составу гликозидаз (табл. 19), которые также могут участвовать в деградации фукоидана в силу гетерогенности его моносахаридного состава, бактерии P. citrea разделились на две подгруппы. Отличительной чертой микроорганизмов одной подгруппы было наличие высокоактивной -N-ацетилглюкозаминидазы (NAGlcB). В нее вошли четыре штамма: АТСС 29719Т (из морской воды), КММ 157, КММ 280 и КММ 327 (из гребешка Patinopecten yessoensis). Микроорганизмы другой подгруппы отличались наличием высокоактивной GalA. Практически все изученные штаммы, наряду с ламинараназой, содержали -глюкозидазу (GlcВ). Мощные агаролитики (КММ 188, КММ 216, КММ 250, КММ 256, КММ 504, КММ 3296, КММ 3297, КММ 3298) проявляли невысокую активность по отношению к растворимой агарозе и синтезировали как GalА, так и -галактозидазу (GalВ).

Таким образом, была изучена способность двенадцати штаммов P. citrea к ферментативной деградации углеводных субстратов, характерных для морской среды. Показано, что штаммы P. citrea КММ 3296 и КММ 3298, выделенные из бурых водорослей F. evanescens и Chorda filum соответственно, а также КММ 3297 — из голотурии A. japonicus содержат перспективные с биотехнологической точки зрения ферменты, катализирующие гидролиз фукоидана.

2.2.2 О-гликозидгидролазы морской бактерии Pseudoalteromonas issachenkonii В талломах бурой водоросли F. evnescens итурупской популяции обнаружен продуцент фукоиданазы, представленный штаммом морской бактерии, валидизированным как новый вид Pseudoalteromonas issachenkonii КММ 3549Т.

Экстракт биомассы этих бактерий содержал ферменты (mU/мг белка): ламинараназу (1,50), альгинат лиазу (0,55), пустуланазу (0,25) и фукоиданазу (0,15). Кроме того, в клеточном экстракте P. issachenkonii КММ 3549 найдены гликозидазы (U/мг белка):

GalВ (5,40), GlcВ (8,80), -ксилозидаза (XylB) и NAGlcB (54,70).

В серии экспериментов по оптимизации состава питательной среды для штамма P. issachenkonii KMM 3549T (табл. 20, 21) было показано, что пептон является значимым для синтеза фукоиданазы, присутствие дрожжевого экстракта и глюкозы не существенно (табл. 20). Оптимальной для синтеза фукоиданазы является концентрация пептона, равная 2,5 г/л питательной среды. Максимальная удельная активность альгинат лиазы наблюдается при концентрации пептона 1 г/л, NAGlcB — 7,5 г/л питательной среды. Увеличение концентрации пептона до 10 г/л приводит к интенсивному росту бактерий, но не к увеличению активностей гликозидгидролаз (табл. 21).

Добавление в среду моносахаридов L-Fuc, D-Xyl, D-Rha и D-Gal, которые в качестве миноров могут входить в состав фукоиданов, показало, что D-Gal и D-Xyl положительно влияют на выход фукоиданаз. Однако D-Gal является положительным фактором также для биосинтеза альгинат лиазы, ламинараназы и NAGlcB, поэтому для дальнейшего исследования была выбрана D-Xyl. Удельная активность фукоиданазы становится максимальной при концентрации D-Xyl равной 5 г/л. Высокая концентрация D-Xyl (10 г/л) в питательной среде ингибирует рост бактерий. Агароза и каррагинан в среде подавляют синтез фукоиданазы бактерией. Фукоидан слабо индуцирует фукоиданазу, но значительно увеличивает синтез NAGlcB.

Таблица Влияние пептона, дрожжевого экстракта и глюкозы на синтез фукоиданазы штаммом Pseudoalteromonas issachenkonii KMM 3549T Фактор варьирования Удельная Общий белок, активность, mU/мг Пептон, 5 Дрожжевой мг/мл D-Глюкоза, белка г/л экстракт, 2 г/л 1 г/л + + - 1,65 - + - 0,40 + - + 0,45 1,- - + 0 + - - 0,59 1,+ + + 1,85 Таблица Влияние веществ на общий белок и уровень активности гликозидгидролаз P. issachenkonii KMM 3549T Общий Удельная активность, mU/мг белка Фактор Концентра белок, Фукоиданаза Ламинариназа Альгинат NAGlcВ варьирования ция, г/л мг/мл лиаза 1 0,03 0,0 0,0 12,6 8,2,5 0,36 1,9 4,4 5,4 7,Пептон 7,5 0,97 1,0 3,8 1,9 10,10,0 1,10 1,2 3,2 2,2 7,L-Фукоза 0,2 8,6 12,6 13,7 5,4 12,D-Галактоза 1 16,3 15,5 14,9 9,6 15,D-Рамноза 1 10,0 7,3 12,7 5,0 7,1 10,6 14,3 12,6 4,6 14,0,5 0,30 4,0 0,7 9,3 5,D-Ксилоза 1 0,35 10,6 14,3 12,6 4,5 0,17 13,5 5,2 12,9 4,Смесь:

D-Галактоза, каждого по 0,35 7,1 1,9 10,9 4,D-Рамноза, 0,D-Ксилоза Агароза 0,36 0 0,34 5,0 2,5 0,Каррагинан 0,59 0 0 4,0 2,5 0,Фукоидан 0,96 0,5 6,6 3,2 10,0 0,Ламинаран 0,65 2,0 26,6 4,7 6,0 0,Альгинат 0,49 2,0 34,0 6,8 5,0 0,Агароза 0,36 0 0,34 5,0 2,5 0,Положительными факторами для продукции фукоиданазы являются ламинаран и альгинат, однако добавление в среду ламинарана и альгината приводит к увеличению удельной активности ламинараназы, что нежелательно, так как это осложняет процедуру очистки фукоиданазы. Важно отметить, что единственным из проверенных ферментов, на синтез которого существенно не влияет присутствие полисахаридовиндукторов, оказалась альгинат лиаза.

Таким образом, варьируя состав питательной среды, можно увеличить выход фукоиданазы. В присутствии D-Xyl (5 г/л) в среде ее активность увеличивается почти на порядок.

2.3 Распространение внутриклеточных фукоиданаз среди морских бактерий семейства Flavobacteriaceae Проведен поиск фукоиданаз среди бактерий семейства Flavobacteriaceae. В качестве субстратов использовали два фукоидана из бурых водорослей F. evanescens (F2) и L. cichorioides (FL). Для выбора лучшего источника фукоиданазы, экстракты бактерий дополнительно анализировали на присутствие полиманнуронат и полигулуронат лиаз, ламинараназ, агараз, амилаз, карбоксиметилцеллюлаз и ряда гликозидаз. Предпочтительными считали штаммы бактерий с более ограниченным набором ферментов.

Таблица Удельная активность*) фукоиданаз и других полисахарид деградирующих ферментов морских бактерий семейства Flavobacteriaceae Среда обитания Субстрат КММ Таксономическое положение РМ PG F2 FL L AP Морская вода 6204 0 14,0 16,4 20,5 1,4 63, Zobellia sp.

Пляжный песок, Коста-Рика 3903T 0 12,6 7,9 16,1 0,6 22, Maribacter sedimenticola Strongylocentrotus intermedius 6055 0 8,9 0 16,3 0 31, Bizionia sp.

Maribacter sp. 6036 14,8 23,0 14,7 14,7 0,3 0, Maribacter sp. 6211 0 6,9 52,4 15,2 7,2 Gramella sp. 6018 0 67,8 0 22,0 18,4 184, Gramella sp. 6053 0 88,1 21,1 13,8 60,3 169, Gramella sp. 6054 0 0 56,8 5,5 48,7 156, Н.и.**) 6038 188,2 254,1 10,3 21,5 5,3 3, Н.и.**) 6051 5,2 23,3 3,08 17,8 0,4 0, Н.и.**) 6207 0 77,3 0 13,0 43,8 178, Н.и.**) 6208 1,1 17,9 7,7 23,4 1,8 1, Н.и.**) 6209 0 0 0 8,5 30,6 248, Н.и.**) 6210 5,4 3,1 32,6 26,9 14,2 32,Laminaria japonica 3676T 0 8,7 0 1,8 67,3 18, Zobellia laminariae Acrosiphonia sonderi 3970 37,5 105,5 15,3 18,4 89,5 26, Algibacter lectus Formosa sp. 3901 1137,6 907,3 98,3 48,8 50,1 101, Mesonia algae 3909T 0 0 55,0 0 0 3, Salegentibacter sp. 6039 5,8 28,4 8,6 23,0 29,7 65, Zobellia sp. 3964 9,4 25,1 8,7 11,0 3,9 44,Ulva fenistrata 3951T 6,6 8,0 0 9,4 0 Maribacter ulvicola Polysiphonia japonica 3908 5,0 139,6 0 11,9 11,1 63, Winogradskyella eximia *) — нмоль/ч мг белка, **) — не идентифицированные штаммы, РМ — полиманнуроновая кислота; PG — полигулуроновая кислота; F2 — фукоидан из бурой водоросли F. evanescens;

FL — фукоидан из бурой водоросли L. cichorioides; L — ламинаран; AP — амилопектин.

Наиболее часто ферменты, действующие на фукоиданы, встречались в изолятах морского ежа S. intermedius. Среди 4 исследованных эпифитов бурых водорослей L. japonica и C. filum невысокая активность по фукоидану FL отмечена только в одном.

Неожиданным оказался тот факт, что фукоиданазу синтезировали бактерии-эпифиты зеленой водоросли A. sonderi, не содержащей фукоиданы. Фукоиданаза морской бактерии M. algae КММ 3909Т проявляла специфичность только к полисахариду F2.

Один изолят зеленой водоросли U. fenistrata синтезировал фермент, деградирующий фукоидан FL. Следует отметить, в эпифитах этой водоросли практически отсутствовали ферменты, действующие на другие полисахариды бурых водорослей:

ламинаран и альгиновые кислоты. Широкой специфичностью обладали фукоиданазы обитателей морской воды и грунта (табл. 22). В виду того, что экстракт биомассы бактерии M. algae КММ 3909Т действовал только на сульфатированный 1,3;1,4--Lфукан F2, а M. ulvicola КММ 3951T — на сульфатированный 1,3--L-фукан FL, можно предположить о наличии в них фукоиданаз, способных катализировать соответственно -1,4-О- и -1,3-О-гликозидные связи между остатками сульфатированной L-Fuc в -L-фукане.

Результаты скрининга были проанализированы с точки зрения таксономического положения бактерий. Представители рода Arenibacter отличались отсутствием ферментов, деградирующих любые полисахариды (рис. 22), и имели одинаковый профиль действующих гликозидаз (см. стр. 10) в независимости от источника выделения. Преобладающим ферментом Arenibacter sp. являлась NAGlcB.

Рис. 22. Распространение ферментов, деградирующих фукоидан, среди морских бактерий родов: 1 — Algibacter; 2 — Arenibacter; 3 — Bizionia; 4 — Formosa; — Gramella; 6 — Maribacter; 7 — Mesonia; 8 — Salegentibacter; 9 — Ulvibacter; 10 — Winogradskyella; — Zobellia; 12 — не идентифицированны. Субстраты: А — фукоидан F2; Б — фукоидан FL; В — фукоиданы F2 и FL. Г — общее количество штаммов бактерий данного рода.

Бактерии рода Zobellia наряду с ферментами, расщепляющими полисахариды (табл. 22, рис. 22), продуцировали ряд гликозидаз (рис. 23). Два экстракта Zobellia sp.

КММ 6204 и КММ 3964 из 8 изученных штаммов, катализировали гидролиз как фукоидана F2, так и фукоидана FL (табл. 22, рис. 22).

Рис. 23. Распространение -N-ацетилглюкозаминидаз (1), -фукозидаз (2), -маннозидаз (3), -галактозидаз (4), -галактозидаз (5), -ксилозидаз (6), -глюкозидаз (7) среди штаммов морских бактерий родов Gramella (А), Maribacter (Б) и Zobellia (В). 8 — общее количество штаммов данного рода.

Способность деградировать фукоиданы обнаружена у бактерий родов Gramella и Maribacter. Гликозидазы морских бактерий Gramella sp. были представлены NAGlcB, GalA, GlcВ и XylB (рис. 23), тогда как профиль гликозидаз бактерий Maribacter sp не отличался от такового исследованных штаммов бактерий рода Zobellia (рис. 23).

Уровень активности ферментов зависел от источника выделения.

В морской бактерии Salegentibacter mishustinae КММ 6049Т — ассоцианте морского ежа S. intermedius, искомых ферментов не обнаружено, а штамм бактерии Salegentibacter sp. КММ 6039, изолированный из зеленой водоросли A. sonderi, синтезировал ферменты, деградирующие фукоидан (табл. 22). Экстракт бактерии Winogradskyella eximia КММ 3908, выделенной из красной водоросли P. japonica, содержал ферменты, действующие на полисахарид FL (табл. 22, рис. 22), а экстракт бактерии Winogradskyella epiphytica КММ 3906Т — ассоцианта зеленой водоросли A.

sonderi — не проявил активности ни по одному из субстратов. В единственном исследованном штамме бактерии Ulvibacter litoralis КММ 3976 ферменты, деградирующие фукоидан, обнаружены не были (табл. 22, рис. 22).

В морских бактериях Formosa sp. КММ 3901, M. algae КММ 3909Т, Maribacter sp.

КММ 6211 и Gramella sp. КММ 6054 активность фукоиданаз была наибольшей (табл.

22), но сравнимой с активностью ферментов морских бактерий рода Pseudoalteromonas. Однако Formosa sp. КММ 3901 также синтезировала высокоактивные альгинат лиазы и полисахаридгидролазы (табл. 22), что может затруднять очистку и исследование фукоиданаз. Достоинством M. algae КММ 3909Т, Maribacter sp. КММ 6211 и Gramella sp. КММ 6054 оставалось почти полное отсутствие других гликозидгидролаз, поэтому они были выбраны для дальнейшего изучения.

Подобно P. issachenkonii КММ 3549Т, уровень фукоиданазной активности штаммов M. algae КММ 3909Т, Maribacter sp. КММ 6211 и Gramella sp. КММ 6054, выращенных на средах, содержащих моносахариды, значительно превышал ее уровень в этих же штаммах, культивированных на среде с добавлением фукоидана F(рис. 24) и увеличивался по мере роста бактерий (рис. 25).

Рис. 24. Влияние D-глюкозы (А), D-ксилозы (Б) и фукоидана F0 (В) на уровень активности фукоидан деградирующих ферментов в штаммах морских бактерий семейства Flavobacteriaceae: — M. algae КММ 3909Т, 2 — Maribacter sp. КММ 6211, 3 — Gramella sp. КММ 6054.

Рис. 25. Активность фукоидан деградирующих ферментов штаммов морских бактерий M. algae КММ 3909Т (1) и Maribacter sp. КММ 6211 (2), выращенных на средах с добавлением соответственно D-глюкозы или D-ксилозы (1 г/л).

Оба штамма культивировали в течение 24 ч (а) и 48 ч (б). А — удельная активность фукоиданаз (мкмоль/ч мг белка), Б — концентрация белка в экстрактах (мг/мл).

Таким образом, в результате проделанной работы было охарактеризовано содержание О-гликозидгидролаз и альгинат лиаз у 51 представителя морских бактерий семейства Flavobacteriaceae. Было показано, что перспективными источниками фукоиданаз являются бактерии M. algae КММ 3909Т, Maribacter sp. КММ 6211 и Gramella sp. КММ 6054. Индуктором биосинтеза фукоиданаз в этих бактериях является D-Xyl.

2.4 Исследование свойств и субстратной специфичности фукоиданазы из морской бактерии Pseudoalteromonas citrea Исследования основных свойств фукоиданаз из морской бактерии Pseudoalteromonas citrea были выполнены на ферментных препаратах, полученных частичной очисткой экстрактов бактерий от низкомолекулярных примесей с помощью гель-фильтрации на сефадексе G-25. В качестве субстарата использовали 1,3--L-фукан из L. cichorioides (FL). Препараты фукоиданаз всех трех штаммов оказались максимально эффективны по действию на фукоидан при рН 6,5-7,0, и сохраняли активность до 40-50С.

Из клеточного экстракта бактерии P. citrea КММ 3296, выращенной на стандартной среде, комбинацией традиционных методов (осаждение сульфатом аммония, анионообменной хроматографии, гельфильтрации и ультафильтрации) выделили препарат фермента, который не содержал GalA, целлюлазы и альгинат лиазы. Молекулярная масса фукоиданазы по результатам гель-фильтрации составляла 80 кДа. Согласно немногочисленным литературным данным, фукоиданазы — высокомолекулярные ферменты с Мм 80-100 кДа.

Для исследования специфичности фукоиданазы из P. citrea к типу О-гликозидной связи в качестве субстратов использовали фукоиданы из бурых водорослей L. cichorioides FL и F. evanescens F2 (табл. 23).

Таблица Характеристика фукоиданов и продуктов их деградации под действием фукоиданазы из Pseudoalteromonas citrea КММ 32Моносахаридный состав, % Молярное Образец Выход, % Mм, кДа отношение Fuc:Gal:Xyl:Rha:Glc:Man Fuc:SO2-FL 60-80 90:1,2:2,8:0:0:6:0 1:1,F2 100 40-60 95:2,0:2,8:0:0:0,2 1:0,Рs-1 70 0,9-0,3 96:4:0:0:0:0 1:0,Рs-2 20 2-3 97,2:0,4:2,1:0,3:0:0 1:0,Под действием препаратов ферментов, полученных частичной очисткой экстрактов бактерий P. citrea КММ 3296, КММ 3297 и КММ 3298 от низкомолекулярных примесей, фукоидан FL был практически полностью деполимеризован до олигосахаридов (рис. 26).

Все продукты ферментативного гидролиза фукоидана FL состояли в основном из остатков L-Fuc. В Н ЯМР-спектрах образовавшихся олигосахаридов наблюдались сигналы c 5,42, 4,36, 4,51 и 1,33 м.д., которые характерны для остатков L-Fuc, сульфатированной по С2 и С4.

В образце фукоидана F2 количество 1,3-связанной Fuc в 3,5 раза преобладало над количеством 1,4-связанной, согласно результатам метилирования десульфатированной фракции этого фукоидана (соотношение ацетатов 2,3-ди-О-Ме :

2,4-ди-О-Ме-фуцита = 11 : 39). Продукты ферментативного гидролиза, полученные в результате действия фермента на фукоидан F2, разделили на две фракции (Рs-1, Рs-2) (рис. 27). По данным моносахаридного анализа продукты Рs-1 и Рs-2 состояли в основном из L-Fuc (табл. 23). Фракция Рs-1, выход которой составил ~ 70% от суммы продуктов, была изучена более детально (табл. 23).

Рис. 26. Профили элюции, полученные после гель-фильтрации на Toyopearl 40-HW (11см, 12 мл/мин) фукоидана FL из L. cichorioides (1) и продуктов его деградации, образовавшихся под действием фукоиданаз бактерий P. citrea КММ 3297 (2), КММ 3298 (3), КММ 3296 (4); 5 — глюкоза.

Рис. 27. Профили элюции, полученные после разделения фукоидана (1) из F. evanescens (F2), а также продуктов его ферментативной деградации Рs-1 и Рs-2 (2) на ДЭАЭ-целлюлозе (315 см, 1,1 мл/мин); 3 — градиент NaCl.

По результатам жидкостной хроматографии фракция Рs-1 оказалась смесью низкомолекулярных олигосахаридов (рис. 28).

Рис. 28. Результаты хроматографирования низкомолекулярных продуктов Рs-1 на жидкостном хроматографе "Jeol" (биогель Р-2, (1100 см); 0,05 М раствор Na+-ацетатного буфера, рН 5,2-5,5, 0,2 М NaCl, 7-9 мл/час).

Выход сахара регистрировали реакцией с 0,15% раствором орцина в 70% H2SO4 при 95°С. 1 — фукоидан, 2 — фракция низкомолекулярных продуктов Рs-1, 3 —L-фукоза.

Сульфатные группы составляли 30% от массы фракции, что соответствует сульфатированию одного из двух остатков L-Fuc. Соотношение ацетатов у полисахарида F2 (2,3-ди-О-Ме- : 2,4-ди-О-Ме-фуцита = 50 : 26) изменилось по сравнению с таковым для исходного полисахарида F0: в исследуемых продуктах стали преобладать олигосахариды, в которых остатки Fuc связаны 1,4-О-гликозидной связью.

Фракция продуктов Рs-2 представляла собой сульфатированные фукоолигосахариды с Мм 2-3 кДа (рис. 29, табл. 23). Величина угла оптического вращения ([]D20) олигосахаридов Рs-2, равная –11° (1,0 мг/мл, H2O), была значительно ниже, чем у полисахарида F2 (–173°), хотя С ЯМР-спектр Рs-оставался идентичным спектру фукоидана F2. Моносахаридный состав Рs-2 сравним с моносахаридным составом исходного полисахарида F2, но количество сульфатов уменьшилось.

Рис. 29. Профили элюции, полученные при гельфильтрации фукоидана из F. evanescens (1) и продуктов его деградации Рs-2 (2), на колонке Superdex 75 HR (130 см, 0,01 М Na+-фосфатный буфер рН 7,2, 0,15 М NaCl, 0,4 мл/мин, петля — 0,мл), запускаемой системой FPLC.

Таким образом, сопоставляя результаты выполненного исследования можно с большой долей вероятности предположить, что фукоиданаза из морской бактерии Pseudoalteromonas citrea является ферментом эндо-типа действия и катализирует гидролиз 1,3--О-гликозидных связей в фукоиданах с образованием фукоолигосахаридов. Фуканаза экзо-типа в изучаемых штаммах, вероятно, отсутствуют, так как L-Fuc, основной продукт их действия, не обнаружена.

Полученные результаты согласуются с литературными данными, касающимися фукоиданаз из -протеобактерий. Так, известно, что бактерия рода Alteromonas SN1009 продуцирует фермент, являющийся эндо-1,3--L-фукоиданазой.

Препараты ферментов из морской бактерии P. citrea КММ 3296 можно использовать для получения сульфатированных фукоолигосахаридов из фукоиданов L. cichorioides и F. evanescens.

ВЫВОДЫ 1. Впервые выполнено систематическое исследование распространения -галактозидаз и -N-ацетилгалактозаминидаз среди морских бактерий, которые были изолированы из морской воды, грунта, животных и водорослей, собранных в различных акваториях Мирового океана. Показано, что доминирующими группами микроорганизмов-продуцентов -галактозидаз и -N-ацетилгалактозаминидаз являются грамотрицательные бактерии родов Pseudoalteromonas и Vibrio.

Установлено, что оба фермента чаще встречаются среди ассоциантов животных.

Продуценты -галактозидаз в основном найдены в акваториях северо-западной части Тихого Океана, -N-ацетилгалактозаминидаз — в тропических водах.

2. Впервые из новой морской бактерии рода Arenibacter latericius KMM 426T выделена -N-ацетилгалактозаминидаза, способная при рН 7,3 устранять групповую специфичность эритроцитов крови человека группы А и проявлять высокую активность в реакции ингибирования гемагглютинации с групповым веществом крови А. Фермент стабилен до 50°С и в физиологических условиях существует в виде гомодимера с молекулярной массой 94 кДа. Экзогенный NAD+ не влияет, а ионы Na+ и Mg2+ увеличивают активность -N-ацетилгалактозаминидазы. С помощью автоматического метода Эдмана установлена N-концевая аминокислотная последовательность (15 а.о.) -N-ацетилгалактозаминидазы.

3. Впервые из новой облигатно морской психротолерантной -протеобактерии Pseudoalteromonas sp. КММ 701 выделена термолабильная -галактозидаза, способная в физиологических условиях (рН 7,3) инактивировать групповую специфичность эритроцитов крови человека группы B и прерывать адгезию патогенной бактерии Corynebacterium diphtheria к клеткам буккального эпителия.

Фермент активен в форме гомодимера с молекулярной массой 170 кДа и катализирует гидролитическое отщепление остатков галактозы с сохранением конфигурации аномерного центра субстрата.

4. Определена N-концевая аминокислотная последовательность (15 а.о.) -галактозидазы. Методами молекулярной биологии установлена нуклеотидная последовательность гена, кодирующего этот фермент, и выведена его полная аминокислотная последовательность, построена теоретическая модель пространственной структуры и активного центра -галактозидазы, выявлено положение каталитических аминокислотных остатков фермента, а также остатков их ближайшего окружения. -Галактозидаза из Pseudoalteromonas sp. КММ 701 отнесена к семейству GH36 клана-D и в кластере бактериальных ферментов образует подсемейство с -галактозидазами из морских -протеобактерий.

5. Методом золь-гель технологии -галактозидаза из Pseudoalteromonas sp. КММ 701 иммобилизована в различные по составу гибридные полисахарид-силикатные нанокомпозитные материалы. Показано, что уровень активности и стабилизация фермента определяется как концентрацией полисахарида в матрице, так и его природой. Предложен оптимальный состав матрицы для иммобилизации -галактозидазы.

6. Изучено влияние широкого ряда природных и синтетических полигидрокси-1,4-нафтохинонов на гидролитическую активность -галактозидазы из Pseudoalteromonas sp. KMM 701. Показано, что ингибирующие свойства этих соединений зависят от природы заместителей, их числа и положения в структуре.

Среди природных полигидрокси-1,4-нафтохинонов со свободными -ОН группами обнаружены обратимые ингибиторы фермента. Ди- и тригалогензамещенные нафтазарины с вицинальным расположением атомов Сl в хиноидном кольце проявляют себя как необратимые высокоэффективные ингибиторы. Фермент можно использовать в качестве тест-системы для обнаружения и оценки количественного содержания высокотоксичных хлорпроизводных нафтазарина, являющихся микропримесями в препаратах синтетического эхинохрома.

7. Разработан способ освобождения фукоидана от полифенольных соединений.

Для контроля качества очистки фукоиданов предложен метод флуоресценции.

Показано, что образцы фукоиданов, свободные от полифенолов, сохраняют биологические свойства, характерные для природного комплекса полисахарида с полифенолами. Высокоочищенный образец фукоидана можно использовать в качестве субстрата для поиска и изучения свойств фукоиданаз.

8. Изучено распространение фукоидан-деградирующих ферментов среди морских бактерий-эпифитов водорослей и ассоциантов морских беспозвоночных.

Высокая активность фукоиданаз отмечена у представителей бактерий родов Alteromonas/Pseudoalteromonas и семейства Flavobacteriaceae, изолятов бурых водорослей и иглокожих. Показано, что фукоиданазы синтезируются штаммами, выделенными из источников, богатых -L-фуканами, и могут служить экофизиологической характеристикой данного вида бактерий.

9. Показано, что -протеобактерия P. issachenkonii KMM 3549T, выделенная из таллома бурой водоросли F. evanescens итурупской популяции, а также морские бактерии семейства Flavobacteriaceae, такие как Mesonia algae КММ 3909Т — изоляты зеленой водоросли A. sonderi, Maribacter sp. КММ 6211 и Gramella sp. КММ 6054 — ассоцианты морского ежа S. intermedius, наряду с фукоиданазами, содержат ферменты, участвующие в деградации как нейтральных, так и полианионных полисахаридов бурых водорослей. Уровень активности фукоиданаз зависит от состава питательной среды бактерий.

10. Установлено, что фукоиданазы бактерий P. citrea КММ 3296 и КММ 3298, изолятов бурых водорослей F. evanescens и C. filum соответственно, а также КММ 3297 — изолята A. japonicus, обладают свойством деполимеризовать фукоиданы по эндо-типу до сульфатированных -L-фукоолигосахаридов. Фермент, выделенный из P. citrea КММ 3296, катализирует гидролиз доступных 1,3--О-гликозидных связей в фукоиданах из L. cichorioides и F. evanescens и является -1,3-L-фуканазой (ЕС3.2.1.-).

11. -N-Ацетилгалактозаминидаза и -галактозидаза морских бактерий, способные к конверсии эритроцитов крови человека, могут найти применение в биотехнологии создания универсальной крови. -Фукоиданаза может быть применена для получения низкомолекулярных биологически активных сульфатированных фукоолигосахаридов. -N-Ацетилгалактозаминидаза и -галактозидаза, а также фукоиданазы могут быть использованы в качестве инструментов для структурных исследований углеводов и углевод содержащих биополимеров, антигенов клеток бактерий и эукариот.

Список основных публикаций по теме диссертации 1. Иванова Е.П., Бакунина И.Ю., Михайлов В.В., Романенко Л.А., Горшкова Н.М., Парфенова В.В., Елякова Л.А. Распространение хитинразлагающих ферментов у морских и пресноводных микроорганизмов // Биология моря. — 1992. — №3-4. — С.

69—75.

2. Бакунина И.Ю., Иванова Е.П., Михайлов В.В., Недашковская О.И., Горшкова Н.М., Парфенова В.В. Распространение -N-ацетилгалактозаминидаз среди морских и пресноводных микроорганизмов // Микробиология. — 1994. — Т. 63, №5. — С. 847— 853.

3. Бакунина И.Ю., Иванова Е.П., Недашковская О.И., Горшкова Н.М., Михайлов В.В., Елякова Л.А. Поиск продуцентов -галактозидаз среди морских бактерий рода Alteromonas // Прикл. биохим. микробиол. — 1996. — Т. 32, №6. — С. 624—628.

4. Иванова Е.П., Бакунина И.Ю., Недашковская О.И, Горшкова Н.М., Михайлов В.В., Елякова Л.А. Распространение морских микроорганизмов, продуцирующих -Nацетилглюкозаминидазы, -галактозидазы, -N-ацетилгалактозаминидазы // Биология моря. — 1998. — Т. 24, №6. — С. 351—358.

5. Бакунина И.Ю., Сова В.В., Недашковская О.И., Кульман Р.А., Лихошерстов Л.М., Мартынова М.И., Михайлов В.В., Елякова Л.А. -Галактозидаза морской бактерии Pseudoalteromonas sp. КММ 701 // Биохимия. — 1998. — Т. 63, №10. — С.1420—1427.

6. Звягинцева Т.Н., Сова В.В., Бакунина И.Ю., Сундукова Е.В., Ермакова С.П., Eлякова Л.А. Морские организмы как источники биологически активных полисахаридов, полисахарид гидролаз с уникальной специфичностью и их ингибиторов // Химия в интересах устойчивого развития. — 1998. — №6. — С. 417— 426.

7. Бакунина И.Ю., Недашковская О.И., Михайлов В.В., Елякова Л.А. Ферменты, изменяющие групповую специфичность эритроцитов крови человека. / Научные разработки для практического использования. Владивосток : Дальнаука. — 1999. — Вып. 2. — С. 9—10.

8. Бакунина И.Ю., Шевченко Л.С., Недашковская О.И., Шевченко Н.М., Алексеева С.А., Михайлов В.В., Звягинцева Т.Н. Поиск фукоиданаз среди морских микроорганизмов // Микробиология. — 2000. — Т. 69, №3. — С. 370—376.

9. Бакунина И.Ю., Недашковская О.И., Алексеева С.А., Иванова Е.П., Романенко Л.А., Горшкова Н.М., Исаков В.В., Звягинцева Т.Н., Михайлов В.В. Особенности деградации фукоидана морскими протеобактериями Pseudoalteromonas citre // Микробиология. — 2002. — Т. 71, №1. — С. 49—55.

10. Ivanova E.P., Bakunina I.Yu., Sawabe T., Hayashi K., Alexeeva Y.V., Zhukova N.V., Nicolau D.V., Zvyagintseva T.N., Mikhailov V.V. Two species of culturable bacteria associated with degradation of brown algae Fucus evanescens // Microb. Ecol. — 2002. — Vol. 43, N 2. — P. 242—249.

11. Недашковская О.И., Иванова Е.П., Бакунина И.Ю., Светашев В.И., Звягинцева Т.Н., Михайлов В.В. Характеристика морских бактерий Pseudoalteromonas citrea, деградирующих фукоидан // Мiкробiол. журн. — 2002. — Т. 64, №2. — С. 3—10.

12. Бакунина И.Ю., Кульман Р.А., Лихошерстов Л.М., Мартынова М.Д., Недашковская О.И., Михайлов В.В., Елякова Л.А. -N-Ацетилгалактозаминидаза из морской бактерии Arenibacter latericius КММ 426Т, устраняющая групповую специфичность А-эритроцитов // Биохимия. — 2002. — Т. 67, №6. — C. 830—837.

13. Alexeeva Y.V., Ivanova E.P., Bakunina I.Y., Zvaygintseva T.N., Mikailov V.V.

Optimization of glycosidases production by Pseudoalteromonas issachenkonii KMM 3549T // Lett. Appl. Microbiol. — 2002. — Vol. 35, N 4. — P. 343—346.

14. Ivanova E.P., Bakunina I.Yu., Nedashkovskaya O.I., Gorshkova N.M., Alexeeva Y.V., Zelepuga E.А., Zvaygintseva T.N., Nicolau D.V., Mikhailov V.V. Ecophysiological variabilities in ectohydrolytic enzyme activities of some Pseudoalteromonas species, P. citrea, P. issachenkonii, and P. nigrifaciens // Curr. Microbiol. — 2003. — Vol. 45, N 1. — P. 6—10.

15. Shchipunov Y.A., Karpenko T.Yu., Bakunina I.Yu., Burtseva Y.V., Zvyagintseva T.N., A new precursor for the immobilization of enzymes inside sol-gel-derived hybrid silica nanocomposites containing polysaccharides // J. Biochem. Biophys. Methods. — 2004. — Vol. 58, N 1. — P. 25—38.

16. Урванцева А.М., Бакунина И.Ю., Ким Н.Ю., Исаков В.В., Глазунов В.П., Звягинцева Т.Н. Выделение очищенного фукоидана из природного комплекса с полифенолами и его характеристика // Химия растит. cырья. — 2004. — №3. — C.

15—24.

17. Кусайкин М.И., Чижов А.О., Алексеева С.А., Бакунина И.Ю., Недашковская О.И., Сова В.В., Звягинцева Т.Н., Еляков Г.Б. Сравнительное исследование специфичности фукоиданаз морских микроорганизмов и беспозвоночных // Доклады РАН. — 2004. — Т. 396, №5. — С. 1—3.

18. Урванцева А.М., Бакунина И.Ю., Недашковская О.И., Ким С.Б., Звягинцева Т.Н. Распространение внутриклеточных фукоиданаз среди бактерий семейства Flavobacteriaceae // Прикл. биохим. микробиол. — 2006. — Т. 42, №5. — С. 552—559.

19. Бакунина И.Ю., Недашковская О.И., Звягинцева Т.Н., Щипунов Ю.А.

Иммобилизация -галактозидазы в гибридных нанокопозитах, содержащих полисахариды // Журн. прикл. химии. — 2006. — Т. 79, Вып. 5. — С. 839—844.

20. Kusaykin M.I., Chizhov A.O., Grachev A.A., Alekseeva S.A., Bakunina I.Yu., Nedashkovskaya O.I., Sova V.V., Zvyagintseva T.N. A comparative study of specificity of fucoidanases from marine microorganisms and invertebrates // J. Appl. Phycology. — 2006.

— Vol. 18, N 3/5. — С. 369—373.

21. Balabanova L.A., Likshatskaya G.N., Bakunina I.Yu., Petruk S.V., Kozhemyako V.B., Rasskazov V.A. Primary structure and homology modeling of the novel -galactosidase from marine bacterium // FEBS J. — 2006. — Vol. 273, PP687. — Р. 262— 263.

22. Кузнецова Т.А., Беседнова Н.Н., Урванцева А.М., Бакунина И.Ю., Звягинцева Т.Н., Дрозд Н.Н., Макаров В.А. Сравнительное исследование биологической активности фукоиданов, выделенных из бурых водорослей // Вестник ДВО РАН. — 2006. — №6. — С. 105—110.

23. Лапикова Е.С., Дрозд Н.Н., Толстенков А.С., Макаров В.А., Звягинцева Т.Н., Шевченко Н.М., Бакунина И.Ю., Кузнецова Т.А., Беседнова Н.Н. Ингибирование тромбина и фактора Ха фукоиданом из Fucus evanescens и его модифицированными аналогами // Бюл. эксп. биол. мед. — 2008. — Т. 145, №9. — С. 304—310.

24. Kusaykin, M.I., Bakunina, I.Yu., Sova, V.V., Ermakova, S.P., Kuznetsova, T.S., Besednova, N.N., Zaporozhets, T.S., Zvyagintseva, T.N. Structure and biological action of the polysaccharides and products of their transformation // J. Biotechnol. — 2008. — Vol. 3, N 7. — P. 904—915.

25. Kiseleva M.I., Bakunina I.Y., Kusaykin M.I., Zvyagintseva T.N. Action of polyanione polysaccharides from the brown seaweeds Fucus evanescens and their modified analogs on reproductive function and development sea urchin embryos Strongylocentrotus intermedius // 1st Far-Eastern International Symposium on Life Sciences. Vladivostok. — 2008. — P. 36.

26. Бакунина И.Ю., Кольцова Е.А., Похило Н.Д., Шестак О.П., Якубовская А.Я., Звягинцева Т.Н., Ануфриев В.Ф. Влияние 5-гидрокси- и 5,8-дигидрокси-1,4-нафтохинонов на гидролитическую активность -галактозидазы // Хим. природ. соедин. — 2009. — №1. — С. 59—63.

27. Balabanova L.A., Bakunina I.Y., Nedashkovskaya O.I., Makarenkova I.D., Zaporozhets T.S., Besednova N.N., Zvyagintseva T.N., Rasskazov V.A. Molecular characterization and therapeutic potential of a marine bacterium Pseudoalteromonas sp.

KMM 701 -galactosidase // Mar. Biotechnol. — 2010. — Vol. 12, N 1. — P. 111—120.

28. Запорожец Т.С., Макаренкова И.Д., Бакунина И.Ю., Бурцева Ю.В., Кусайкин М.И., Балабанова Л.А., Звягинцева Т.Н., Беседнова Н.Н., Рассказов В.А.

Ингибирование адгезии C. diphtheriae к буккальному эпителию человека гликозид гидролазами из морских гидробионтов // Биомедицинская химия. — 2010. — Т. 56, N 3.

— C. 350—358.

29. Патент N 2113479 Российская Федерация, МКИ6 С 12 N 9/40//(С 12 N 9/40, C 12 R 1:01). Штамм бактерий Pseudoalteromonas sp. — продуцент -галактозидазы / Недашковская О.И, Бакунина И.Ю., Сова В.В., Михайлов В.В., Елякова Л.А., Кульман Р.А. — № 97107819/13; Заявл. 23.04.97; Опубл. 20.06.98, Бюл. № 17. — 7 с.

30. Патент N 2141526 Российская Федерация, МКИ6 С 12 N 9/40//(С 12 N 9/40, C 12 R 1:20). Штамм бактерий Flavobacterium sp. — продуцент -N-ацетилглюкозаминидазы / Недашковская О.И., Бакунина И.Ю., Кульман Р.А., Лихошерстов Л.М., Мартынова М.И., Михайлов В.В., Елякова Л.А. — № 98111673/13;

Заявл. 17.06.98; Опубл. 20.11.99., Бюл. № 32. — 10 с.

31. Патент N 2207370 Российская Федерация, МКИ7 С 12 N 1/20, 9/40, 9/36//(С N 9/40, C 12 R 1:38). Pseudoalteromonas issachenkonii КММ 3549Т — продуцент фукоиданазы и питательная среда для его культивирования / Алексеева Ю.В., Бакунина И.Ю., Иванова Е.П., Звягинцева Т.Н., Михайлов В.В. — № 2002102089/13;

Заявл. 01.07.02; Опубл. 27.12.03., Бюл. № 36. — 6 с.






© 2011 www.dissers.ru - «Бесплатная электронная библиотека»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.