WWW.DISSERS.RU

БЕСПЛАТНАЯ ЭЛЕКТРОННАЯ БИБЛИОТЕКА

   Добро пожаловать!

ИНСТИТУТ БИООРГАНИЧЕСКОЙ ХИМИИ им. академиков М.М. ШЕМЯКИНА и Ю.А. ОВЧИННИКОВА РОССИЙСКОЙ АКАДЕМИИ НАУК

На правах рукописи

ШУВАЕВА Татьяна Маратовна НОВЫЕ БЕЛКИ ОБОНЯТЕЛЬНОГО ЭПИТЕЛИЯ МЛЕКОПИТАЮЩИХ.

СТРУКТУРНО-ФУНКЦИОНАЛЬНЫЕ ИССЛЕДОВАНИЯ 02.00.10-биоорганическая химия

АВТОРЕФЕРАТ

диссертации на соискание ученой степени доктора химических наук

МОСКВА-2008

Работа выполнена в лаборатории белков гормональной регуляции Института биоорганической химии им. академиков М.М. Шемякина и Ю.А. Овчинникова Российской академии наук

Научный консультант:

доктор химических наук, чл.-корр. РАН Липкин Валерий Михайлович

Официальные оппоненты:

доктор химических наук, академик РАН Островский Михаил Аркадьевич доктор химических наук, профессор Румш Лев Давыдович доктор медицинских наук, профессор Соодаева Светлана Кельдибековна Ведущая организация – ФГУП Государственный научно-исследовательский институт генетики и селекции микроорганизмов

Защита состоится « » октября 2008 г. В 10 час. на заседании специализированного совета Д 002.019.01 при Институте биоорганической химии им. академиков М.М. Шемякина и Ю.А. Овчинникова РАН по адресу: 117997, Москва, ул. Миклухо-Маклая 16/10.

С диссертацией можно ознакомиться в библиотеке Института биоорганической химии им. академиков М.М. Шемякина и Ю.А. Овчинникова РАН.

Автореферат разослан « » сентября 2008 г.

Ученый секретарь специализированного совета, доктор физ.-мат. наук В.А. Олейников

ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ

Актуальность проблемы. Обмен веществ между организмом и окружающей средой – основная функция эпителиальной ткани как пограничного образования. Некоторые из этих тканей, такие как обонятельная выстилка, ткани респираторного эпителия и другие, непосредственно контактируют с атмосферой и в норме покрыты слизью, которая является первым барьером между ними и окружающим воздухом и, фактически, обеспечивает нормальное функционирование всех тканей дыхательной системы и, следовательно, всего организма в целом.

Для поддержания жизнедеятельности организма через слизь осуществляется транспорт важных веществ, например, кислорода – в респираторном эпителии, пахучих стимулов – в обонятельной выстилке. Но одновременно через этот секрет в эпителий поступают вещества, которые могут быть токсичными для клеток. Действие этих факторов в органах и тканях респираторной системы нейтрализуется путем самоочищения дыхательной поверхности с помощью фагоцитоза, неспецифической бактерицидной защиты органов дыхания радикальными соединениями, генерируемыми активированными фагоцитами, специфической иммунной защитой от инфекционных возбудителей и чужеродных макромолекул, обезвреживанием токсичных веществ и липофильных эндогенных макромолекул. Нарушение работы этих систем является причиной развития многих заболеваний различной этиологии.

Большая физиологическая значимость понимания процессов регулировки механизмов защиты организма предопределяет интенсивность исследований самых различных структурно-функциональных аспектов этих систем, в частности, проводятся работы по поиску и характеризации белковых регуляторных компонентов обонятельной слизи, называемых (если пользоваться медицинской терминологией) «белками первой линии защиты». Несмотря на достигнутый прогресс в этой области в течение последних лет, многие молекулы, важные для поддержания гомеостаза в органах дыхания, все еще остаются неизвестными, т.к. выделение белковых компонентов в индивидуальном виде и их идентификация имеют свои специфические трудности. Это обстоятельство сдерживает прогресс в изучении реально существующих защитных механизмов эпителиальных тканей воздухоносных путей, нормальное функционирование которых представляет собой основу естественной невосприимчивости организма к болезням. Вышеизложенное позволяет заключить, что идентификация и структурно-функциональное исследование белков обонятельной выстилки является актуальной проблемой физико-химической биологии.

Цель и задачи исследования. Основной целью настоящей работы явился поиск, идентификация и исследование новых белковых компонентов, непосредственно контактирующих с окружающей средой клеток. Для достижения поставленной цели потребовалось решить следующие задачи:

1. Разработать методы очистки и выделить в индивидуальном состоянии новые, ранее неизвестные полипептиды из обонятельной выстилки крысы.

2. Определить частичную аминокислотную последовательность этих полипептидов и отобрать белки, являющиеся потенциально значимыми для функционирования эпителиальных тканей.

3. Клонировать структурные гены ранее неизвестных белков и определить их нуклеотидную последовательность; установить полную аминокислотную последовательность новых белков и идентифицировать участки цепей природных продуктов, имеющих посттрансляционные модификации.

4. Создать рекомбинантные аналоги новых белков и изучить особенности их функционирования.

5. Выявить клеточную локализацию новых белков, изучить их функциональную роль в механизмах клеточной защиты эпителиальных тканей.

В ходе данной работы был открыт основной антиоксидант респираторных тканей – 1-Cys-содержащий пероксиредоксин (Prx VI). В связи с этим была поставлена отдельная задача по разработке условий получения высокоактивных генно-инженерных аналогов пероксиредоксина VI человека и сравнения его антиоксидантных свойств с природным белком.

Научная новизна работы. В процессе исследования разработана методика и осуществлено выделение в гомогенном виде двух новых, неописанных ранее белков респираторного эпителия крысы c молекулярными массами 28 и 45 кДа.

Впервые установлено, что в слизи обонятельного эпителия в значительных количествах (2%) присутствует новый тип тиол-специфических пероксидаз и липид-переносящий белок, Sec14p-подобный белок, несущий в своем составе CRAL/TRIO- или Sec14p-подобный домен.

На основе информации о частичной аминокислотной последовательности осуществлено клонирование кДНК этих белков. По определенной нуклеотидной последовательности установлена полная первичная структура этих белков, состоящая из 223 и 400 аминокислотных остатков, соответственно. Установлено, что тиол-специфическая пероксидаза принадлежит к семейству пероксиредоксинов VI и в ее составе идентифицирован домен, способный защищать белки от разрушения активными формами кислорода, подобно полноразмерному ферменту. Изучены особенности химического строения Prx VI и показано, что белок не гликозилирован; отсутствие посттрансляционной модификации имеет важное значение для проявления белком протекторной активности.

Впервые показано, что наибольшая концентрация этих белков обнаруживается в тканях, имеющих непосредственный контакт с атмосферой и больше, чем другие, подверженных воздействию неблагоприятных внешних факторов. На основании полученных данных сделано предположение, что эти белки входят в состав защитных систем эпителиальных тканей и обеспечивают их нормальный контакт с окружающей средой.

Нами установлено, что ключевой посредник сигнальных путей фосфатидилинозит-3,4,5-трифосфат является специфическим липидным лигандом Sec14p-подобного белка тканей респираторной системы. Доказана колокализация этих веществ в клетках млекопитающих и выявлено участие липид-связывающего Sec14p-подобного белка в секреторном процессе. Впервые продемонстрирована транспортная активность Sec14p-подобного белка млекопитающих и возможность переноса фосфатидилинозит-3,4,5-трифосфата во внеклеточную среду.

Практическая ценность работы. На основе белка пероксиредоксина VI для тканей, контактирующих с внешней средой, предложен принципиально новый специализированный препарат антиоксидантного действия, направленный, в первую очередь, на восстановление редокс-баланса тканей органов дыхания. В модельных экспериментах на животных показана высокая эффективность действия этого белка на восстановление эпителиальных тканей верхних дыхательных путей. В связи с потенциальной практической важностью Prx VI на его использование оформлена международная заявка.

Получены высокоактивные генно-инженерные аналоги пероксиредоксина VI человека и осуществлено сравнение их протекторных свойств с природным белком.

В ходе определения липид-связывающей специфичности Sec14p-подобного белка разработан новый простой и не требующий использования радиоактивных липидов метод изучения липид-белковых взаимодействий. Метод позволяет исследовать транспортную активность белков по отношению к липидному лиганду и в случае, когда тип липидного соединения не известен.

Апробация работы. Результаты работы были представлены на следующих симпозиумах и конференциях: IV, VII и VIII Чтениях, посвященных памяти академика Ю.А. Овчинникова (Москва, 1998, 2004 и 2006 гг., соответственно); II Съезде биофизиков России (Москва, 1999 г.); INTAS Симпозиуме «Микробные и клеточные системы для фармакологии, биотехнологии, медицины и экологии» (Москва, 1999 г.); NATO-FEBS Конференции «Белки, липиды и мембранный транспорт» (Франция, Каргез, 1999 г.); Х Международной конференции «Новые информационные технологии в медицине и экологии» (Украина, Гурзуф, 2002 г.);

7 Международном симпозиуме «Биомолекулярные структуры» (Великобритания, Шеффилд, 2004); Московской конференции по компьютерной молекулярной биологии, (Москва, 2005 г.); Международной конференции «Новые концепции липидологии» (Нидерланды, Нарвайкерхуд, 2006 г.) Публикации. По материалам диссертации опубликовано 33 работы, в том числе 2 обзорные статьи в книгах, 7 статей в рецензируемых российских журналах, рекомендованных Высшей аттестационной комиссией, 7 статей в иностранных журналах, входящих в систему цитирования Web of Science, и патента.

Личный вклад автора. Автору принадлежит решающая роль в выборе направления исследований, разработке и проверке предложенных в работе экспериментальных подходов, обсуждении, оформлении и обобщении полученных результатов. За исключением биомедицинских исследований по оценке лечебного действия пероксиредоксина VI (выполненных в Институте биофизики клетки под руководством проф., д.б.н. Новоселова В.И.), экспериментальная работа выполнена автором, а также студентами, аспирантами и сотрудниками (под руководством автора). В исследованиях, проведенных в соавторстве с зарубежными коллегами, личный вклад автора заключался в постановке задачи, непосредственном участии в руководстве при проведении экспериментальной работы, выполнении ряда экспериментов, в обсуждении полученных результатов и оформлении их в виде публикаций.

Объем и структура диссертации. Диссертационная работа изложена на____страницах печатного текста и включает в себя ____ рисунков и ___ таблиц.

Диссертация состоит из введения, обзора литературы, результатов и их обсуждения, экспериментальной части, выводов и списка цитируемой литературы, состоящего из ____ наименований.

СОДЕРЖАНИЕ РАБОТЫ

К началу настоящей работы было известно, что в слизи обонятельной выстилки крысы присутствуют два новых полипептида, проявляющиеся при электрофорезе в полиакриламидном геле (ПААГ) в присутствии додецилсульфата натрия (SDS) в виде мономерных белков с молекулярными массами 28 и кДа соответственно. Оба полипептида (далее в тексте «р28» и «р45») не совпадали по молекулярным массам с уже ранее описанными белками этой ткани и в сумме составляли 4 % всех белков слизи. Р45 давал положительную реакцию с поликлональными антителами, полученными к синтетическому пептиду, соответствующему GTP-связывающему участку аминокислотной последовательности, общему для -субъединиц всех известных G-белков, однако субстратом для холерного или коклюшного токсинов не являлся.

Поскольку аминокислотная последовательность р28 и р45 не была известна, идентифицировать эти белки и установить их биологическую роль в механизме функционирования эпителиальной ткани млекопитающих не представлялось возможным.

1. Пероксиредоксин обонятельного эпителия крысы 1.1. Очистка, идентификация и определение частичной аминокислотной последовательности белка р28, пероксиредоксина VI В качестве источника для выделения р28 использовался изотонический экстракт обонятельных выстилок крыс линии Вистар. Первоначальное фракционирование экстракта осуществляли с помощью ионообменной хроматографии на DEAE-Сефацеле и Сефакриле S-200. После 2-х стадийной хроматографии по данным электрофореза в ПААГ в присутствии SDS роказывался уже в значительной мере гомогенным: его чистота составляла 95 %. Но, во избежание осложнений с идентификацией молекулы с неизвестной функцией, обычно сопряженных с возможным присутствием в препарате примесных полипептидов, связанных с исследуемой молекулой спонтанно образующимися в процессе выделения дисульфидными мостиками, частично очищенный препарат белка дополнительно денатурировался, модифицировался 4-винилпиридином и наносился на колонку Нуклеосил 300-7 RP, уравновешенную 0,1 % трифторуксусной кислотой. После продолжительной промывки, представляющей собой фактическое обессоливание алкилированного препарата р28, связавшиеся белки элюировали с колонки градиентом ацетонитрила в обычно принятых условиях. Белок, выходящий с колонки отдельно стоящим доминирующим острым пиком, дающий при электрофоретическом анализе в ПААГ в присутствии SDS кажущуюся молекулярную массу 28 кДа и имеющий остаток Pro в качестве N-концевого, использовался для дальнейших исследований.

Первым шагом к идентификации р28 и выяснению его функции было определение N-концевой аминокислотной последовательности белка:

Pro-Gly-Gly-Leu-Leu… При сравнении этой структуры с последовательностями, хранящимися в PIR и GenBank банках данных, был обнаружен белок – селен-несодержащая глутатионпероксидаза из цилиарного тела быка (PIR банк, А60604), N-концевая последовательность которого точно совпадала с определенной структурой (рис.1). Полная аминокислотная последовательность этой глутатионпероксидазы на тот момент еще не была известна, но абсолютная идентичность N-концевых структур этих белков позволила сделать предположение о высокой гомологии этих белков, о принадлежности их к одному семейству и, как следствие, существовании пероксидазной активности и у р28.

Рис. 1. Анализ частичной аминокислотной последовательности р28. Участки цепи, полученные при определении N-концевой структуры р28 и аминокислотной последовательности пептидов (К1-К3) его лизинспецифического гидролизата – (а); Nконцевая последовательность глутатионпероксидазы из цилиарного тела быка - (б); фрагменты аминокислотной последовательности гипотетического белка человека ORF6 - (в).

Для установления полной аминокислотной последовательности очищенный препарат модифицированного р28 гидролизовался Lys-специфичной протеиназой. При разделении полученного гидролизата с помощью офВЭЖХ был выделен ряд пептидов, причем установление последовательности уже для трех из них дало возможность найти в базах данных гипотетический белок из миелобластомы человека (ORF6), чья структура, предположительно, должна быть аналогична последовательности р28 (рис. 1).

Поскольку аминокислотная последовательность гипотетического белка была выведена из нуклеотидной и данные о его функции отсутствовали, был проведен поиск гомологов ORF6. Было выявлено несколько белков с разной степенью подобия с последовательностью ORF6, но на тот момент наибольшим сходством (64%) обладал тиол-специфичный фермент -антиоксидант («TSA») из нематоды Onchocerca volvulus (Chandrashekar R. et all., GenBank 1995, U31052). Таким образом, было предположено, что р28 принадлежит к классу тиол-специфичных антиоксидантов или, согласно современной терминологии, пероксиредоксинов (Prx).

Для того чтобы окончательно прояснить, является ли очищенный белок, имеющий N-концевой остаток Pro, тиол-специфическим антиоксидантом, была проверена его способность проявлять свою антиоксидантную активность в окислительной системе Fe3+/DTT/O2, способной генерировать активные формы кислорода (АФК), в присутствии тиола.

Рис. 2. Защита глутаминсинтетазы E. coli от АФК с помощью р28 в металл/DTT/окислительной системе. Инактивационная смесь содержала 5 мкг глутаминсинтетазы, 3 мМ DTT, 3 мкМ FeCl3 в объеме 60 мкл. В смесь дополнительно добавлялись: (•) – 1 мМ EDTA; ( )- 0 мг/мл р28; ( ) – 0, 002 мг/мл р28; ( ) – 0,010 мг/мл р28;

() – 0,1 мг/мл р28.

На рис. 2 представлена кривая защиты глутаминсинтетазы Echerichia coli от окисления с помощью немодифицированного р28. В отсутствие р28 в реакционной смеси уже после 5 мин. инкубации падение активности фермента составляло величину 90 % (рис. 2). Присутствие 10 мкг/мл р28 защищало глутаминсинтетазу уже на 50 %. Когда концентрация р28 в реакционной смеси составляла 100 мкг/мл инактивации фермента практически не наблюдалось.

Таким образом, было получено прямое подтверждение, что рдействительно является Prx и защищает в присутствии тиолов белки от действия АФК.

1.2. Установление и анализ полной аминокислотной последовательности пероксиредоксина VI В общей сложности была установлена последовательность лизинспецифичных пептидов (К1 – К5). Эти сведения позволили обнаружить в базах данных еще два белка, первичные структуры которых содержали гомологичные р28 участки: продукт регулируемого фактором роста кераноцитов мыши гена KRG-1, идентифицированный как селен-несодержащая глутатионпероксидаза (EMBL 1997, Y12883), и гипотетический белок LTW4 из печени мыши (GenBank 1997, AF 004670). Поскольку KRG-1 и LTW4 были полностью между собой идентичны, был сделан вывод, что все они, в том числе и изучаемый полипептид и гипотетический белок ORF человека, являются видоспецифическими изоформами одного и того же белка.

Благодаря тому, что были найдены изоформы р28, удалось определить последовательность расположения лизинспецифичных фрагментов в полипептидной цепи белка:

К3 К5 + К1 К2 КНа основе структуры пептидов, расположенных ближе к N-концу молекулы белка, были синтезированы прямые праймеры (1 и 2), а на основе структуры К2, расположенного ближе к С-концевому остатку, был синтезирован обратный праймер (3) (табл. 1). Олигонуклеотидные праймеры (1) и (3) были использованы для получения фрагмента кДНК Prx методом ПЦР с использованием в качестве матрицы амплифицированной фаговой библиотеки из обонятельного эпителия крысы, созданной на основе вектора NM1149 (клонирование кДНК по EcoRIсайту).

Таблица 1. Олигонуклеотидные праймеры, использованные для получения фрагментов кДНК Prx методом ПЦР Шифр пептида, Нуклеотидная Степень № аминокислотная структура вырож- праймера последовательность денности 5’ К3 GC(G/T)CCIGAGTTTGC(G/T)A 1 …APEFAK A(A/G)3’ 5’ K5 K1 TGGAGTAAGGATATIAATG 2 …WSK DINAY… C(G/T)TA(T/C)3’ 5’ K2 TTIGTGGAA(G/A/T/C)A 3 KGVFTK C(G/A/T/C)CC(T/C)TT3’ Эта библиотека была любезно предоставлена проф. H. Бреером (Университет Гугенгейма, Штудгарт, Германия). Полученный после амплификации фрагмент кДНК («D») имел длину, соответствующую ожидаемой (рассчитанной на основе данных по структурам гомологичных белков), и гибридизовался с [-32P]-меченным олигонуклеотидным зондом (2).

Амплифицированный фрагмент был клонирован в плазмиду pSp65 по сайту HindII.

Отбор рекомбинантных клонов проводили гибридизацией с [-32P]меченным олигонуклеотидным зондом (2). В результате было получено два клона, определение нуклеотидной последовательности вставок которых показало их полную идентичность и высокую гомологию с кДНК белков, обнаруженных ранее при сравнении частичной аминокислотной последовательности Prx со структурами, хранящимися в базах данных.

D Рис. 3. Схема строения кДНК Prx из обонятельного эпителия крысы клона a26.1 и относительное расположение ПЦР-фрагмента D. Черный прямоугольник соответствует кодирующей области, белые – 5’- и 3’-нетранслируемым областям. Стрелками обозначены положения на цепи олигонуклеотидных праймеров (1) и (3), использованных для синтеза ПЦРфрагментов кДНК, и зонда (2) для отбора содержащих их клонов.

Идентификацию клонов, содержащих кДНК Prx, проводили гибридизацией in situ фаговых бляшек (5х105) с [-32] -меченным ПЦР-фрагментом кДНК исследуемого белка. В результате моноклонизации было получено несколько положительных клонов, среди которых был отобран клон (a26.1), содержащий вставку кДНК р28 с максимальной длиной (рис. 3). EcoRI-EcoRI фрагмент кДНК из фага a26.1 был субклонирован для рестриктного и структурного анализов.

Полученная нуклеотидная последовательность и выведенная из нее полная первичная структура р28 представлены на рис. 4. Открытая рамка считывания между нуклеотидными основаниями 35 и 709 кодировала полную аминокислотную последовательность Prx.

Все частичные аминокислотные последовательности, выявленные при анализе целого белка и его лизинспецифического гидролизата, кодировались этой открытой рамкой считывания. Анализ N-концевой структуры Prx показал, что остаток Met, кодируемый инициирующим кодоном ATG, отщепляется в процессе пост-трансляционной модификации, и зрелый белок включает в себя 2аминокислотных остатка, в том числе единственный остаток Cys46.

Сравнение полной аминокислотной последовательности исследуемого белка со структурами, хранящимися в базах данных, подтвердило, что белок с кажущейся молекулярной массой ~ 28 кДа, выделенный из обонятельного эпителия крысы и имеющий N-концевой остаток Pro, относится к семейству Prx.

GCGCCTCCTTGTTCCCAGCGTCACCACTGCCGCC -ATGCCCGGAGGGCTGCTTCTCGGGGACGAAGCCCCCAACTTTGAGGCCAATACCACCATCGGCCACATCCGCTTC P G G L L L G D E A P N F E A N T T I G H I R F CACGATTTCCTAGGAGATTCATGGGGCATTCTCTTTTCCCACCCACGGGACTTTACCCCAGTGTGCACCACAGAA 1 H D F L G D S W G I L F S H P R D F T P V C T T E CTTGGCAGAGCTGCAAAGCTGGCGCCAGAGTTTGCCAAGAGGAATGTTAAGTTGATTGCTCTTTCAATAGACTCT 2 L G R A A K L A P E F A K R N V K L I A L S I D S GTTGAGGACCATTTTGCCTGGAGCAAGGACATCAATGCTTACAATGGTGCAGCACCCACAGAAAAGCTACCATTT 3 V E D H F A W S K D I N A Y N G A A P T E K L P F CCCATCATCGACGATAAGGACAGGGACCTTGCCATCCTGTTGGGCATGTTGGATCCAGCAGAGAAGGATGAAAAA 3 P I I D D K D R D L A I L L G M L D P A E K D E K 1GGCATGCCCGTGACAGCCCGTGTGGTATTCATTTTTGGCCCTGACAAGAAACTAAAACTGTCCATCCTCTACCCA 4 G M P V T A R V V F I F G P D K K L K L S I L Y P 1GCCACCACGGGCAGAAACTTTGATGAGATTCTCAGAGTGGTTGACTCCCTCCAGCTGACAGCATCAAATCCAGTT 5 A T T G R N F D E I L R V V D S L Q L T A S N P V 1GCCACTCCAGTTGACTGGAAGAAGGGAGAGAGTGTGATGGTCCTTCCCACCCTCCCTGAAGAGGAAGCCAAACAA 6 A T P V D W K K G E S V M V L P T L P E E E A K Q 1CTTTTCCCTAAAGGAGTCTTCACCAAAGAGCTCCCATCTGGCAAGAAATACCTCCGTTATACGCCCCAGCCTTAA 6 L F P K G V F T K E L P S G K K Y L R Y T P Q P • 2GTCTGCGGGAACTGGGGCTGCAACTGCTCGACCAGCACTGGGACCTGAGGATGACAGCTGACAGCTGCAGTTCCG 7TAGAAAGATTGTGGCGTGGTCACAGCCGAAGTCGCGTAGGTCGCTCGCTATACTACTGGCTCATTAAATGGAAAT 8GGCACCAAAACATTCTCGGGATTCTTTACTCTGTGCCTTCGCCAGCATTCTGCCCCTCCATCCATCACAGCGCCC 9TGCTGACTGGCTTTCTTTGAAACGAATTATGTGTTGGTGACTGCAGGGTCTCTGCAGGGTCTGTGATCAGCAAGG 9TAGTGTCAGTGTGGGCTCCATGCTAGAATGATAAACATCTTTTGTAGGTTTCCAAACTGAATCTTCTGTTACCCA 10TTGTGGAGAACCATAAAGTGGGGAGAAACTTTCAATTCTGTACTTTCAGTAAATAAAGCAGGGGAGGTGGGGGGG 11GGGGGAGAGTTCTCTATAGGAAATCCATGGTGAGTTTCTATCAAAGTGGGCTTCCAAGAATGTGTGGAAGACAGC 12ACATGTACTTCCTGGAGTTTCCAGGTCTGCTCTCTAGTGATCTGTGAATGTGAACTCGCCTTATGAAAGACAGGC 12AGTGACATTGTTTGCCACTAAATGTCCTAAAGGAGTGGGTTGCCATTTCTAAATTCTGCTGTGTGAGGTTCAACA 13ATAAAATCCTGATTAGAAAAAAAAAAAAAA 13Рис. 4. Нуклеотидная последовательность кДНК р28 из обонятельного эпителия крысы и реконструированная полная первичная структура белка. Подчеркнуты последовательности, определенные методами белковой химии. В 3’ – нетранслируемой области подчеркнуты сайты полиаденилирования.

В настоящее время известно уже более 200 представителей этого семейства, обнаруженных практически во всех организмах (от бактерий до человека) и отличающихся высокой консервативностью. На рис. 5 представлено сравнение первичной структуры р28 с последовательностями лишь некоторых из них.

Р28 как и все пероксиредоксины в составе N-концевой части цепи содержит консервативную последовательность P39xDFTPVCxTE49 с существенным остатком Cys, представляющую собой активный центр фермента. Поскольку у многих других представителей этого семейства в С-концевом фрагменте находится еще один функционально важный консервативный остаток Cys, например, Cys173 у MSP23, Cys172 у NKEF-A, Cys170 у YTSA (рис. 5), все пероксиредоксины, в зависимости от общего числа консервативных остатков Cys (вариабельных остатков Cys может быть значительно больше), делятся на два подсемейства: 1-Cys- и 2-Cys- содержащие Prx.

p28 PGG-LLLGDEAPNFEANTTI--G---HIRFHDFLGDSWGILFSHPRDFTPVCTTELGRA ORF6 MPGG-LLLGDVAPNFEANTTV--G---RIRFHDFLGDSWGILFSHPRDFTPVCTTELGRA PER1 MP-G-LTIGDTVPNLELDSTH--G---KIRIHDYVGNGYVILFSHPGDFTPVCTTELAAM MSP23 MSSGNAKIGYPAPNFKATAVMPDGQFKDISLSEYKG-KYVVFFFYPLDFTFVCPTEIIAF NKEF-A MASGNAQIGKSAPDFTATAVV-DGAFKEIKLSDYRG-KYVDLFFYPLDFTFVCPTEIIAF SP-22 A---PAVTQHAPYFKGTAVV-SGEFKEISLDDFKG-KYLVLFFYPLDFTFVCPTEIIAF YTSA V---AEVQKQAPPFKKTAVV-DGIFEEISLEKYKG-KYVVLAFVPLAFSFVCPTEIVAF AhpC MSLINTKIKP-FKNQAFK-NGEFIEVTEKDTEG-RWSVFFFYPADFTFVCPTELGDV p28 AKLAPEFAKRNVKLIALSIDSVEDHFAWSKDINAYNGAAPTEKLPFPIIDDKDRDLAILL ORF6 AKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILL PER1 ANYAKEFEKRGVKLLGISCDDVQSHKEWTKDIEAYK---PGSKVTYPIMADPDRSAIKQL MSP23 SDRADEFKKLNCQVIGASVDSHFCHLAWINTPKKQ-G--GLGPMNIPLISDPKRTIAQDY NKEF-A SDHAEDFRKLRCEVLGVSVDSQFTHLAWINTPRKE-G--GLGPLNIPLLADVTKSLSHNY SP-22 SDKASEFHDVNCEVVAVSVDSHFSHLAWINTPRKN-G--GLGHMNIALLSDLTKQISRDY YTSA SDAAKKFEDQGAQVLFASTDSEYSLLAWTNLPRKD-G--GLGPVKVPLLADKNHSLSRDY AhpC ADHYEELQKLGVDVYSVSTDTHFTHKAWHSSS--E----TIAKIKYAMIGDPTGALTRNF p28 GMLDPAEKDEKGMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTASN- ORF6 GMLDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEK- PER1 NMVDPDEKDAQGQ-LPSRTLHIVGPDKVVKLSFLYPSCTGRNMDEVVRAVDSLLTAAKH- MSP23 GVLKADE----GI--SFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQFTDKH- NKEF-A GVLKNDE----GV--AYRGLFIIDASGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEH- SP-22 GVLLEGP----GL--ALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQFVEAH- YTSA GVLIEKE----GI--ALRGLFIIDPKGIIRHITINDLSVGRNVNEALRLVEGFQWTDKN- AhpC DNMREDE----GL--ADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAAHP p28 PVATPVDWKKGESVMVLPTLPEEEAKQLFPKGVFTKELPSGKKYLRYTPQP ORF6 RVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP 91.5% PER1 KVATPANWKPGECVVIAPGVSDEEAKKMFPQGFETADLPSKKGYLRFTKV- 52.0% MSP23 GEVCPAGWKPG-SDTIKPDVNK--SKEYFSKQK 31.4% NKEF-A GEVCPAGWKPG-SDTIKPNVDD--SKEYFSKHN 31.4% SP-22 GEVCPANWTPE-SPTIKPHPTA--SREYFEKVNQ 27.3% YTSA GTVLPCNWTPGA-ATIKPDVKD--SKEYFKNANN 25.1% AhpC GEVCPAKWKEGE-ATLAPSLD------LVGKI 24.7% Рис. 5. Сравнение первичной структуры р28 с последовательностями некоторых представителей семейства пероксиредоксинов. Условные обозначения: р28-Prx VI из обонятельного эпителия крысы, Genbank Y17295; ORF6 – Prx VI человека, GenBank D14662;

PER1- гипотетический белок ячменя, GenBank Х96551; MSP22 – стрессовый белок мыши, SWISS-PROT Р35700; NKEF-A - белковый фактор человека, усиливающий активность естественных киллеров, SWISS-PROT Q06830; SP-22 - митохондриальная тиоредоксинзависимая пероксиредуктаза быка, SWISS-PROT P35705; YTSA- тиол-специфический антиоксидант дрожжей Saccharomyces cerevisiae, SWISS-PROT Q04120; AhpC - субъединица С алкилгидроксипероксидазы бактерий Salmonella typhimurium, SWISS-PROT P19479. Жирным шрифтом выделены аминокислотные остатки, инвариантные во всех последовательностях;

серым цветом – остатки, идентичные у двух и более представителей семейства пероксиредоксинов. Прочерки введены для оптимизации выравнивания. Цифры справа соответствуют степени идентичности приведенных последовательностей относительно структуры р28.

Учитывая наличие в полипептидной цепи p28 только одного остатка Cys, был сделан вывод, что белок, выделенный из обонятельного эпителия крысы и обладающий протекторным действием in vitro в тиол-окислительной системе, относится к подсемейству 1-Cys-содержащих Prx и, согласно недавно предложенной номенклатуре для ферментов млекопитающих, называется Prx VI.

1.3. Локализация пероксиредоксина VI в тканях млекопитающих Ферментативные антиоксиданты локализованы не только в определенных клеточных компартментах, но и специализированы в отношении отдельных форм АФК, поэтому после идентификации исследуемого белка сразу возник вопрос:

для жизнедеятельности каких органов и тканей может быть наиболее важно протекторное действие пероксиредоксина VI. Совместно с д.б.н., проф. В.И.

Новоселовым (ИБК РАН, лаборатория механизмов рецепции, зав. лаб. чл.-корр.

Фесенко Е.Е.) были выполнены эксперименты по исследованию локализации Prx VI в различных тканях крысы.

На рис. 6 (1b) представлены данные по локализации Prx VI в обонятельной выстилке, полученные с помощью световой иммуногистохимии. Prx VI интенсивно выявлялся во всех областях обонятельной выстилки (обонятельной и респираторной). Его максимальное содержание наблюдалось в апикальной части эпителия, в обонятельной слизи и клетках боуменовых желез. Аналогичная картина наблюдалась и в случае трахеи (рис. 6, 2b) – Prx VI выявлялся в апикальной части ткани трахеи и слизи. В случае легких Prx VI обнаруживался только в бронхах (рис. 6, 3b), и его максимальная концентрация наблюдалась в апикальной части бронх. Паренхима (альвеолы, кровеносные сосуды) легкого не проявляла иммунореактивности против поликлональных антител к Prx VI. В случае кожи иммуноокрашивание наблюдалось в слое гранулярных клеток эпидермиса (рис.6, 5b). В коже, содержащей волосяной покров, также интенсивно окрашивались клетки сальных желез волосяных фолликул. В других исследованных тканях (печень, мышцы, почки, матка) наблюдалось только очень слабое диффузное распределение Prx VI.

Поскольку не всегда место локализации белков совпадает с местом синтеза (в частности, белки могут транспортироваться с током слизи) также были проведены эксперименты по in situ гибридизации этих срезов с антисенс пробой фрагмента мРНК Prx VI (рис. 6, 1с –5с).

Из перечисленных выше тканей на радиоавтографах максимальный Рсигнал выявлялся в обонятельном эпителии, и распределение сигнала вдоль эпителия показывало, что синтез белка идет в слое эпителия, содержащем тела обонятельных, опорных и стволовых клеток (рис. 6, 1с). В то же время по данным иммуногистохимии максимальное содержание белка наблюдается в обонятельной слизи. Аналогичные результаты получены и для трахеи и бронхов (рис. 6, 2с, 3с). В коже распределение Р-сигнала точно совпадало с локализацией Prx VI. Таким образом, максимальное содержание Prx VI мы наблюдали в определенных структурах эпителиальных тканей, а именно только в тех областях, которые непосредственно связаны с атмосферой.

Рис. 6. Локализация пероксиредоксина VI и его мРНК в обонятельном эпителии (1), трахее (2), легком (3), коже со спины (4) и с подушек лапы (5) крысы. « a » -Окрашивание гематоксилином и эозином; « b » - иммуногистохимическое выявление Prx VI пероксидазным методом, краситель ДАБ; « c » - экспрессия мРНК Prx VI, выявленная методом гибридизации. Срезы гибридизовались с Р-меченой антисенс РНК пробой, визуализация в «темном поле». Шкала 100 мкм.

В силу анатомического строения и особенностей функционирования, действию атмосферного воздуха в первую очередь подвержены ткани органов дыхания. И прямые биохимические эксперименты по истощению экстрактов тканей обонятельного эпителия, трахеи и бронхов по Prx VI показали, что этот белок является основным антиоксидантом этих клеток, и его вклад в нейтрализацию АФК составляет более 70%.

Рис. 7. Процесс регенерации ран (1-3) и гистохимические исследования фибробластов грануляционной ткани через 8 дней после надреза (4, 5). 1 – сразу после надреза; 2- через суток после надреза без обработки; 3- через 5 суток после надреза с применением Prx VI; 4- регенерация раны в норме (-участок рубца); 5- регенерация раны с применением Prx VI.

Многочисленные патологии органов дыхания (астма, аллергия, тепловые и химические ожоги и т.д.) сопровождаются так называемым «респираторным взрывом», который характеризуется резким увеличением АФК в тканях органов дыхания. В медицинской практике для диагностики и лечения этих заболеваний применяются известные (ставшие уже классическими) ферменты-антиоксиданты:

супероксиддисмутаза, каталаза, глутатионпероксидазы. Тот факт, что основным антиоксидантом тканей, непосредственно контактирующих с внешней средой, является именно пероксиредоксин VI, изменил подход к данной ситуации и стимулировал большое число экспериментов по изучению его лечебных и защитных эффектов.

Исследование влияния аппликации Prx VI на процесс регенерации раны и образование рубца продемонстрировано на рис. 7. Эти эксперименты показали, что заживление раны с аппликацией Prx VI происходит в два раза быстрее, не переходит в длительную воспалительную фазу и, что особенно важно, сопровождается образованием рубца значительно уменьшенных размеров.

После получения такого рода результатов стало очевидно, что Prx VI может являться новым лекарственным препаратом, способствующим регенерации поврежденных тканей и органов. Поэтому дальнейшие исследования были посвящены разработке методов получения функционально активных рекомбинантных препаратов Prx VI.

1.4. Получение функционально активного рекомбинантного препарата Prx VI. Выделение и очистка рекомбинантных белков Экспрессия кДНК пероксиредоксина VI в эукариотической системе Pichia pastoris Поскольку в состав молекулы Prx VI входит последовательность -Asn-ThrThr- (16-18, рис. 4), представляющая собой потенциальный участок действия гликозилтрансфераз, было предположено, что остаток Asn16, входящий в эту структуру, может быть гликозилирован. Более того, известно, что наличие остатка Thr в положении +1 от остатка Asn увеличивает эту вероятность до 90 %.

Поэтому для получения препаративных количеств биологически активного препарата белка биомедицинского назначения была первоначально выбрана система экспрессии в метилотрофных дрожжах P. pastoris, сочетающая в себе преимущества экспрессии в E. coli (высокий уровень синтеза белка и низкая стоимость работ) с преимуществами экспрессии в эукариотической системе («правильное» сворачивание полипептидной цепи и возможность получения посттрансляционно модифицированных продуктов).

Для экспрессии полноразмерного гена р28 крысы в P. pastoris был выбран вектор pPIC9, включающий в себя сигнальный 86-членный -пептид кислой фосфатазы дрожжей, обеспечивающий секретируемый синтез продукта.

Трансформацию клеток GS115 (his4) предварительно линеаризованной (с помощью BglII рестриктазы) экспрессионной плазмидой pPIC9-28kD(rat), любезно предоставленной доктором Л. Бриандом (Институт национальных агрономических исследований, Жуи-Жуза, Франция), проводили методом электропорации. Отобранные клоны с His+MutS-фенотипом использовали для культивирования в инкубаторе Aerotron (Infors, France). Культуральную среду осветляли центрифугированием, диализовали и анализировали с помощью анионообменной хроматографии (рис. 8). Фракции, содержащие рекомбинантные белки, мигрирующие в ПААГ в присутствии SDS с кажущимися молекулярными массами ~ 28 кДа, обессоливали и лиофилизовали.

В результате этого разделения было получено два образца (объединенные пробирки 3 и 4 и 7-10, рис. 8) рекомбинантных препаратов белков, со следующими, соответственно, N-концевыми последовательностями:

-9 -1 +(I) GluGluGlyValSerLeuGluLysArg/ProGlyGlyLeuLeuLeuGlyAspGlu… (II) ProGlyGlyLeuLeuLeuGlyAspGluAlaProAsnPheGluAla… a Время, мин.

б Рис. 8. Анализ культуральной среды дрожжевых клеток, трансформированных экспрессионной плазмидой pPIC9-28 kD(rat). (а) – хроматографическое разделение с помощью QAE-Вайдека; (б) – электрофореграмма полученных фракций При сравнении этих данных с аминокислотной последовательностью Prx VI стало очевидно, что препарат белка (II), имеющий N-концевой остаток Pro, скорее всего, является наиболее близким рекомбинантным аналогом Prx VI, а другой полипептид (I) – удлиненным вариантом Prx VI, который содержит на Nконце молекулы 9-членный неотщепленный фрагмент сигнальной последовательности.

Для подтверждения того, что наработанный белок (II) является генноинженерным пероксиредоксином крысы, было проведено массспектрометрическое исследование продуктов расщепления этого белка трипсином и бромцианом. В этих экспериментах, проведенных совместно с Институтом национальных агрономических исследований (лаборатория структурных белковых исследований, зав. лаб. проф. Дж. Пернолетт), было установлено, что полученный препарат белка является аналогом пероксиредоксина VI крысы, и что в его составе присутствует гликозилированный остаток Asn16, причем количество гексозных остатков в его гликановой цепи варьируется от 9 до 14.

Рис. 9. Схема анализа рекомбинантного препарата Prx, полученного в эукариотичской системе дрожжей P. рastoris. Красным цветом отмечены фрагменты, выявленные с помощью масс-спектрометрического анализа в триптическом гидролизате белка, а зеленым - пептид, идентифицированный после расщепления белка бромцианом. Участок гликозилирования отмечен стрелкой. Для удобства выделения участков действия трипсина в первичную структуру Prx введена косая черта. Вертикальной стрелкой отмечен модифицированный остаток Asn16.

Рис. 10. Масс-спектр природного Prx VI, выделенного из обонятельного эпителия крысы.

Схема анализа рекомбинантного р28 крысы представлена на рис. 9. В экспериментах in vitro ни пероксидазной, ни протекторной активностью этот препарат практически не обладал (~2- 5 % от природного).

Единственным существенным структурным отличием рекомбинантного препарата от природного, которое могло бы быть причиной резкого падения активности, может являться наличие гликозилированного остатка Asn16.

Для подтверждения этого предположения был проведен массспектрометрический анализ природного р28, выделенного из обонятельной выстилки крысы (рис. 10). Как видно из этого рисунка, молекулярная масса природного препарата (24680 Д) практически полностью совпадает с расчетной (24630 Д), т.е природный пероксиредоксин VI пост-трансляционно не модифицирован.

20015010050Nat 190 200 210 220 230 240 250 E.coli -50Pichia -100 -150wavelength, nm Рис. 11. Спектры КД в дальней УФ-области пероксиредоксинов VI: природного крысы (Nat), рекомбинантного крысы (Pichia) и рекомбинатного пероксиредоксина человека (E. coli).

Только конформационными затруднениями, вызываемыми наличием гликановой цепи вблизи активного центра Prx (Cys 46), вряд ли можно объяснить почти полное отсутствие функциональной активности у рекомбинантного препарата. Поэтому было высказано предположение, что дополнительное введение гликановой цепи в процессе трансляции существенно изменяет пространственную организацию белка и препятствует правильному сворачиванию молекулы. Для подтверждения этого предположения были проведены сравнительные спектральные исследования конформационного состояния различных образцов Prx VI (рис. 11).

Даже простой визуальный анализ спектров КД исследуемых образцов белков, снятых в неденатурирующих условиях, показывает, что рекомбинантный полипептид, полученный c помощью эукариотичской дрожжевой системы P.

рastoris, деструктурирован, не имеет выраженной вторичной структуры и не находится в конформации, необходимой для проявления ферментативной активности белка. Поэтому дальнейшие эксперименты по получению функционально активного препарата Prx VI человека было решено проводить с помощью прокариотической системы экспрессии в E. coli.

Экспрессия кДНК пероксиредоксина VI человека в прокариотической системе Echerichia coli Полноразмерная кДНК пероксиредоксина VI человека НА0683 (ORF6, любезно предоставлена С.И. Фейнстейн, США) была клонирована в вектор pET23-a(+) по сайтам рестриктаз NdeI-EcoRI. Для последующей работы была отобрана плазмида pET23-a(hPrxVI), содержащая под контролем промотора фага Т7 открытую рамку считывания, включающую в себя инициаторный ATG – кодон, кДНК Prx VI человека и стоп кодон ТАА. Полученная плазмида была использована для трансформации клеток E. coli BL21.

Рекомбинантный белок с молекулярной массой, соответствующей ожидаемой, был обнаружен во фракции водорастворимых белков, полученной после разрушения клеток с помощью ультразвука.

Рис. 12. Электрофореграмма (а), вестерн-блот (б) суммарных белков клеток E. сoli штамма BL21, содержащих плазмиду pET23-a(hPrxVI), через 4 ч после индукции IPTG (колонки 1) и препарата полноразмерного рекомбинантного белка (колонки 2) после двух стадий хроматографической очистки. Цифры в середине – молекулярная масса белков-маркеров.

Стрелкой указано положение рекомбинантного Prx VI человека. Сравнение протекторных свойств природного («1») и рекомбинантного пероксиредоксинов VI («2») – (в).

Поскольку степень гомологии аминокислотных последовательностей крысы и человека составляет 92 %, вестерн-блот анализ очищенного рекомбинантного белка человека (рис. 12) с использованием поликлональных антител кролика к природному Prx VI крысы свидетельствовал о том, что белок, мигрирующий при электрофорезе в ПААГ в присутствии SDS с кажущейся молекулярной массой кДа и концентрация которого резко возрастала в клетках E. coli после индукции IPTG, является Prx VI человека (hPrx VI). Для дальнейшего изучения свойств рекомбинантного белка он был получен в препаративном количестве и очищен с с помощью двухстадийной хроматографии согласно методике, разработанной ранее для выделения природного белка из обонятельного эпителия крысы (DEAE-Сефацель и Сефакрил S-200). Выход электрофоретически чистого белка достигал 60 мг из 1 л культуры.

а б в Рис. 13. Информационная структура Prx VI (а) и электрофореграмма суммарных белков клеток E. сoli штамма BL21, трансфецированных плазмидами pET23-a(hPrxVI), pET23-a(hPrxVI178) или pET23-a(hPrxVI124) (б). Протекторные свойства полноразмерного рекомбинантного пероксиредоксина VI человека и его фрагментов по защите глутаминсинтетазы E. coli от инактивации в модельной окислительной системе in vitro (в).

Для подтверждения того, что полученный в клетках E. сoli рекомбинантный Prx находится в нативной конформации, было проведено сравнение его спектра КД со спектром природного белка крысы (рис. 11). Эти данные указывают на присутствие выраженной вторичной структуры в обоих полипептидах. Поскольку природный и полученный с помощью прокариотической системы экспрессии рекомбинантный пероксиредоксины содержат примерно одинаковое количество и -спиралей ( 38%), и -структуры ( 31%), конформационное состояние этих белков можно охарактеризовать как одинаковое, т.е. этот рекомбинантный белок, очевидно, находится в нативной конформации.

С использованием теста по защите от инактивации глутаминсинтетазы в модельной окислительной системе была проверена протекторная активность рекомбинантного препарата (рис. 12). В качестве положительного контроля в этом эксперименте был использован природный Prx VI крысы. Значительный протекторный эффект рекомбинантного Prx VI человека был обнаружен уже при концентрации белка 25 мкг на 1 мл (сохранялось 40% активности глутаминсинтетазы), а при концентрации 100 мкг активность глутаминсинтетазы сохранялась практически полностью, что сравнимо с данными, полученными при исследовании природного белка крысы. В настоящее время биологически активные препараты Prx VI человека синтезируются только в прокариотической системе.

Для усиления фармакологического воздействия лечебной композиции, в состав которой входит Prx VI человека (увеличения клеточной проницаемости белка), было желательно укоротить его полипептидную цепь, т.е. создать функционально активный делеционный мутант белка. Мы воспользовались теоретическим расчетом «информационных структур» и выяснили, что Prx VI условно можно разделить на 4 доменообразующие области («IDIC»- ассоциации, рис. 13). Учитывая тот факт, что активный центр белка расположен в N-концевой области молекулы (отмечена красным на рис. 13), были синтезированы фрагменты, укороченные как бы «подоменно» последовательно с С-конца полипептидной цепи hPrx VI: hPrxVI 178 – минус одна IDIC- ассоциация (отмечена фиолетовым) и hPrxVI 124 – минус две IDIC- ассоциации (фиолетовая и зеленая). На рис. 13 (в) приведены также результаты анализа протекторной активности синтезированных препаратов. Защитный эффект наблюдался только в случае использования hPrxVI 178. Белок, кодируемый hPrxVI 124, пероксидазной активностью (и, как следствие, протекторной) не обладал. Полученные данные ставят под сомнение имеющиеся в литературе данные о том, что для проявления ферментативной активности 1-Cysсодержащих пероксиредоксинов (т.е. Prx VI млекопитающих) необходимо существование димерной формы фермента, образованной по типу «голова к хвосту».

В настоящее время белок, соответствующий последовательности 1-1полипептидной цепи Prx VI человек, наряду с полноразмерным вариантом используется в составе композиций, разработанных в ИБК РАН для лечения ряда заболеваний, связанных с нарушениями редокс-баланса в органах дыхательной системы.

2. Sec14p-подобный белок обонятельного эпителия крысы 2.1. Очистка и идентификация в обонятельном эпителии крысы хитиназы YM-Первым шагом в серии исследований по идентификации другого мажорного белка выстилки, составляющего значительную часть (2%) всех водорастворимых белков этой ткани и дающего положительный сигнал к антителам против общего консервативного для всех G-белков участка (CGAGESGKSTIVKQMK), было получение его в гомогенном состоянии. После двух стадий хроматографической очистки (ионообменной и ситовой) при электрофоретическом анализе в ПААГ в присутствии SDS он выявлялся в виде индивидуальной полосы с кажущейся мол.м. 45 кДа («р45»). Эта полоса имела на N-конце остаток Tyr. После денатурации и обработки 4-винилпиридином была установлена ее N-концевая последовательность, содержащая 10 аминокислотных остатков:

Tyr-Gln-Leu-Met-Cys-Tyr-Tyr-Ser-Trp-Ala-… Для идентификации и выявления предполагаемой функции этого белка он был подвергнут расщеплению Glu- специфичной протеиназой из S. aureus. С помощью офВЭЖХ из стафилококкового гидролизата этой белковой материи был выделен ряд индивидуальных фрагментов. Стафилококковые пептиды(G1G4), чья аминокислотная последовательность была однозначно определена, представлены в таблице 2.

Таблица 2. Аминокислотная последовательность пептидов, выделенных из стафилококкового гидролизата белка, мигрирующего с кажущейся массой 45 кДа Шифр Аминокислотная Местоположение пептида последовательность в цепи белка YM-G1 (E)AMLRKYME ? G2 (E)ITYTHE 44-G3 (E)MRKAFE 141-1G4 (E)GATE 292-2При сравнении полученных данных со структурами, хранящимися в базах данных, был обнаружен гипотетический белок, структура которого содержала из 4 искомых участков (G2-G4) и чья N-концевая аминокислотная последовательность полностью совпадала с ранее определенной. Этот полипептид был зарегистрирован под названием «YM-1» (GenBank M94584, рис.

14) и включал в себя последовательность, характерную для хинолитических ферментов (хитиназ, гликогидролаз семейства 18).

Несмотря на отсутствие хитина в организмах млекопитающих, к настоящему времени у крысы, мыши и человека обнаружен целый ряд гомологичных ферментов, имеющих подобную YM-1 аминокислотную последовательность и объединенных в семейство хитиназоподобных белков или «CLPs». Не все известные представители этого семейства обладают ферментативной активностью, и биологическая роль CLPs в организмах млекопитающих неизвестна.

YQLMCYYTSWAKDRPIEGSFKPGNIDPCLCTHLIYAFAGMQNNEITYTHEQ DLRDYEALNGLKDKNTELKTLLAIGGWKFGPASFSAMVSTPQNRQIFIQSV IRFLRQYNFDGLNLDWQYPGSRGSPPKDKHLFSVLVKEMRKAFEEESVEKD IPRLLLTSTGAGIIDVIKSGYKIPELSQSLDYIQVMTYDLHDPKDGYTGEN SPLYKSPYDIGKSADLNVDSIISYWKDHGAASEKLIVGFPAYGHTFILSDP SKTGIGAPTISTGPPGKYTDESGLLAYYEVCTFLNEGATEVWDAPQEVPYA YQGNEWVGYDNVRSFKLKAQWLKDNNLGGAVVWPLDMDDFSGSFCHQRHFP LTSTLKGDLNIHSASCKGPY3Рис. 14. Аминокислотная последовательность хитиназы YM-1. Красным цветом отмечены пептиды, идентифицированные в гидролизате препарата белка с молекулярной массой кДа, выделенного из обонятельного эпителия крысы.

Важной причиной, обострившей в последние годы интерес исследователей к этой группе ферментов, является тот факт, что развитие многих видов CD4+T(Th2)-зависимых воспалительных и аллергических заболеваний, проходящих с опосредованным участием IL-4 или IL-13, связано с накоплением в слизистых оболочках тех или иных представителей CLPs.

2.2. Установление и анализ полной аминокислотной последовательности р45 из обонятельного эпителия крысы Поскольку предполагаемая аминокислотная последовательность хитиназы YM-1 не включала в себя участок, даже отдаленно подобный GTPсвязывающему, а выходы фрагментов G2-G4 не превышали выхода G1, был сделан вывод, что белковая материя, проявляющаяся при электрофоретическом анализе в виде единичной полосы с молекулярной массой 45 кДа, не является индивидуальным соединением, а представляет, скорее всего, смесь двух полипептидов с приблизительно одинаковыми значениями молекулярных масс и изоэлектрических точек. Одним из компонентов смеси является YM-1, другим (т.е. «истинным» р45) – неизвестный белок, имеющий, очевидно, закрытый Nконцевой остаток и содержащий в своем составе участок, гомологичный GTPсвязывающим последовательностям.

Удобным способом разделения этой двухкомпонентной белковой смеси оказалась экстракция 0,1 % раствором ТФУ в присутствии 5 % ацетонитрила. В этих условиях YM-1 полностью переходил в растворимую фазу, а выпавший осадок представлял собой другое индивидуальное соединение. Гидролиз очищенного таким образом р45 лизинспецифичной протеиназой из Lysobacter enzymogenes и разделение полученного гидролизата проводили в обычно принятых условиях. В этих экспериментах однозначно было идентифицировано 5 фрагментов белка (L1-L5), причем структура пептида L1 перекрывалась с последовательностью G1.

На основе структур L1-L5 не удалось сконструировать достаточно специфичные олигонуклеотидные праймеры, необходимые для проведения следующих этапов работы. Поэтому для получения дополнительных данных об аминокислотной последовательности р45 было проведено его расщепление Gluспецифичным ферментом из Bacillus intermedius, любезно предоставленной проф.

Руденской Г.Н. (МГУ, Москва). Согласно литературным данным, протеиназа из B. intermedius сохраняет свою ферментативную активность даже в присутствии 2 М мочевины. Это делает ее чрезвычайно удобным инструментом для изучения первичной структуры белков, свернутых в устойчивую глобулу с труднодоступными для гидролиза пептидными связями, хотя специфичность расщепления в этом случае заметно понижается.

Полная аминокислотная последовательность двенадцати пептидов и частичная трех, полученных в результате фрагментации р45 протеиназами из L.

enzymogenes и B. intermedius, составляющая в общей сложности более трети цепи р45 (140 а.о.), представлена в таблице 3.

Таблица 3. Аминокислотная последовательность пептидов, полученных при протеолизе р45 протеиназой из L. enzymogenes (L1 -L5) и B. intermedius (B1 – B7) Шифр Аминокислотная последовательность Местоположение пептида в цепи белка L1 SEAMLRK 52-L2 INYGGEIPK 258-2L3 LISPEELPAHFGGTLTDPD… 231-2L4 FRENVQD… 19-L5 PLVEVYQEFF 166-1В1-1 VLTSQR 236-2В1-2 RYNAH 241-2В2-1 GNSWKE 221-2В2-2 LISPEE 231-2В2-3 VGDLSPK 5-В3 YVRDQVKTQYE 269-2В4 WLR 41-В5 VLLPDEGMQKYDEE 383-3В6 FFGLLEENYPE 174-1В7 NVQDVLPALPNPDDYFLLR 22-Наиболее подходящими для синтеза олигонуклеотидных праймеров оказались пептид В2-1 и фрагменты пептидов В3 и В5. В связи с тем, что взаимное расположение вышеуказанных фрагментов известно не было, на основе структуры каждого из них было синтезировано по паре соответствующих праймеров: прямой (гомологичный мРНК) и обратный (комплиментарный мРНК) (табл. 4). Все возможные сочетания праймеров (4)- (9) были использованы для получения фрагментов кДНК р45 методом ПЦР с использованием в качестве матрицы амплифицированной фаговой библиотеки кДНК на основе вектора NM1149 из обонятельного эпителия крысы.

Таблица 4. Олигонуклеотидные праймеры, использованные для получения фрагментов кДНК р45 методом ПЦР Шифр пептида, № прай- Степень аминокислотная Нуклеотидная структура мера вырожден- последовательность ности 5’ GATGAGGGIATGCA( A/G) 4 ВAA( A/ G)TA3’ …DEGMQKY… 5’ GTATTTTTGCATICC(T/C) 5 TC (A/G)TC3’ 5’ GATCAGGTIAA(A/G)ACI 6 BCA(A/G)TA (T/C)GA3’ …DQVKTQYE 5’ TTCGTATTGIGT(T/C)TTI 7 AC(T/C)TG(A/G) TC3’ 5’ GGIAA(T/C)AG(T/C)TGG 8 B2-AA(A/G)GA3’ GNSWKE 5’ TTCTTTCCAGCT(A/G) 9 TT(G/A/T/C)CC3’ Воспроизводимые результаты были получены в случае использования для ПЦР праймеров: (5) -(8), которые на схеме строения кДНК исследуемого белка обозначены как I –IV (рис. 15).

Рис. 15. Схема строения кДНК р45 из обонятельного эпителия крысы. Представлено относительное расположение клонированных фрагментов кДНК клонов r2.2, r4.1, r17.1, r22.1, r35.2 и ПЦР-фрагментов А, В и С. Черный прямоугольник соответствует кодирующей области, белые – 5’ и 3’-нетранслируемым областям. Стрелками обозначены положения на цепи олигонуклеотидных праймеров (I)- (IV), использованных для синтеза ПЦР-фрагментов кДНК.

Соответствующие продукты ПЦР были обозначены А, В и С (рис. 15).

Амплифицированные фрагменты кДНК А (180 п.о.), В (520 п.о.) и С (360 п.о.) были клонированы в плазмиду pGEM-5Zf(+), выделены и отсеквенированы.

Открытая рамка считывания продукта ПЦР (А) кодировала аминокислотную последовательность, включающую в себя структуры пептидов В2-1, В2-2, L3, Lи В3; (В) – В2-1, В2-2, L3, L2, В3, В1-1, В1-2 и В5; (С)- В3, В1-1, В1-2 и В5. На основании этих данных был сделан вывод, что все три проанализированных продукта ПЦР представляют собой фрагменты кДНК р45.

Идентификацию рекомбинантных бактериофагов NM1149, содержащих кДНК р45, проводили гибридизацией in situ фаговых бляшек со специфическим ДНК-зондом, в качестве которого использовали [-32P]-меченый ПЦР-фрагмент С кДНК р45. В результате моноклонизации было получено пять индивидуальных клонов r2.2, r4.1, r17.1, r22.1, r35.2, вставки кДНК которых были отсеквенированы.

Клон r2.2, содержащий вставку кДНК р45 с максимальной длиной, имел открытую рамку считывания, кодирующую полную структуру р45 (рис. 15).

Вставки остальных были короче, и в них отсутствовала последовательность, кодирующая N-концевую область белка. Полученная нуклеотидная последовательность и выведенная из нее структура р45 представлена на рис. 16.

Триплет ATG, находящийся в положении 1-3, имеет окружение специфическое для точки инициации трансляции и является, по всей вероятности, инициирующим кодоном. Открытая рамка считывания между нуклеотидными основаниями 1 и 1200 кодирует полную 400-членную аминокислотную последовательность р45. Все последовательности, выявленные при анализе протеолитических пептидов, кодируются этой открытой рамкой считывания. Без учета возможной пост-трансляционной модификации Nконцевого остатка Ser, следующего по цепи за остатком Met в молекуле р45, рассчитанная молекулярная масса белка, имеющего остаток Met в качестве Nконцевого, составляет 46026 Да. Эта величина соответствует подвижности белка, оцененной с помощью электрофореза в ПААГ в присутствии SDS.

Белок характеризуется высоким содержанием отрицательно заряженных аминокислотных остатков, рассчитанное значение его изоэлектрической точки составляет 5,7 и в своем составе содержит участок (262-275), подобный GTPсвязывающим участкам регуляторных G-белков. Семейство GTP-связывающих белков довольно многочисленно. Помимо вышеупомянутых G-белков, наиболее изученными его членами являются транскрипционные факторы, участвующие в биосинтезе белков, протоонкогенные ras-белки, продукты генов rab, rho, rac, известные как «малые G-белки», тубулин и некоторые киназы. И способность поликлональных антител против синтетического пептида, общего для альфасубъединиц G-белков, выявлять р45 вряд ли может быть на сегодняшний день весомым аргументом в пользу отнесения р45 к этому семейству.

Рис. 16. Нуклеотидная последовательность кДНК р45 из обонятельного эпителия крысы и реконструированная полная аминокислотная последовательность белка. Участки, соответствующие пептидам с установленной структурой, подчеркнуты (L1-L5) или выделены серым цветом (В1-1-В7). В рамку заключены места отличий структуры ПЦР-фрагмента С и кДНК клона r22.1 от структуры кДНК других клонов и ПЦР-фрагментов А и В. Стрелками обозначены положения нуклеотидных вставок в клоне r22.1. В 3’-нетранслируемой области подчеркнут ID элемент, сайт полиаденилирования обозначен ромбами.

p45 1 MSGRVGDL---SPKQAETLAKFRENVQD-----------VLPALPNPDDYFLLRWLRARNFDLQKSEAMLRKYMEFR-KTMDIDHI hTAP 1 MSGRVGDL---SPRQKEALAKFRENVQD-----------VLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFR-KQKDIDNI RALBP MSLR-EQMGADTL SEC14 22 LPGTPGNL---DSAQEKALAELRKLLED-----------A-GFIERLDDSTLLRFLRARKFDVQLAKEMFENCEKWR-KDYGTDTI -TTP 10 VGKQLNEQPDHSPLVQPGLAELRRRAQEEG---------VPETPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSAD CRALBP 45 LQKAKDELNEKEETREEAVRELQELVQAQAASGEELALAVAERVQARDSAFLLRFIRARKFDVGRAYELLKGYVNFRLQYPELFDS p45 72 L-D--WQPPE-VIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDLLKTKMRDCERILH-ECDLQTERLGRKIETIVMI hTAP 72 I-S--WQPPE-VIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQ-ECAHQTTKLGRKVETITII RALBP 13 IAE--YTPPD-VIQKFMTGGDVGHDKDGSVLRIEPWGYLDMKGIMYSCKKSDLEKSKLLQCEKHLK-DLEAQSEKVGKPCTGLTVV SEC14 92 LQDFHYDEKP-LIAKFYPQYYHKTDKDGRPVYFEELGAVNLHEMNKVTSEERMLKNLVWEYESVVQYRLPACSRAAGHLVETSCTI -TTP 87 L-H--PRSILGLLKAGYHGVLRSRDPTGSRVLIYRISYWDPK----VFTAYDVFRVSLITSELIVQ-E--VETQRNGVKA-----I CRALBP 131 L-S--MEALRCTIEAGYPGVLSSRDKYGRVVMLFNIENWHCE----EVTFDEILQAYCFILEKLLE-N--EETQINGFCI-----V p45 153 FDCEGLGLKHFWKPLVEVYQEFFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGNSWKEGLLKLISPEELP hTAP 153 YDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVP RALBP 95 FDMENVGSKHMWKPGLDMYLYLVQVLEDNYPEMMKRLFVINAPTLFPVLYKLVKPLLSEDMKNKIFVLGGDYKDTLLEYIDAEELP SEC14 177 MDLKGISISSAYS-VMSYVREASYISQNYYPERMGKFYIINAPFGFSTAFRLFKPFLDPVTVSKIFILGSSYQKELLKQIPAENLP -TTP 158 FDLEGWQISHAFQITPSVAKKIAAVVTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKGRIHLHGNNYKSSLLQHF-PDILP CRALBP 202 ENFKGFTMQQAAGLRPSDLKKMVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDL-DGFFQEIDENILP comon peptide GAGESGKSTIVK-QMK p45 239 AHFGGTLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFLKTKM hTAP 239 VEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKM RALBP 181 AYLGGTKSE--GDEKCSELICHGGEVPKEFYLENTDDFETMETITVGSGDKIYVEYEIENENTYIKWEYKTEEHDIGFGLF----- SEC14 262 VKFGGKSEV--DESKGGLYLSDIGPWRDPKYIGPEGEAPEAFSMK -TTP 243 LEYGGNESSMEDI-CQEWT-NF-IMKSEDYLSSISETIQ CRALBP 287 ADFGGTLPKYDG--KVVAEQLF-GPRAEVENTAL p45 325 GERQKAGEMTEVLTSQRYNAHMVPEDGSLTCTEAGVYVLRFDNTYSFVHAKKVSFTVEVLLPDEGMQKYDEELTPI hTAP 325 GERQRAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQLGAGTPK RALBP 260 --RKNGDEWEEVVPIERTDCSIMTLDGSHKCKDPGTYALCFDNSFSMMTSKNVRYTAEVMDPEVDSEDINKMIKDSTWDELSAQIS Рис. 17. Сравнение полной аминокислотной последовательности р45 со структурами, хранящимися в SWISS-PROT и GenBank базах данных. Условные обозначения: р45 –белок из обонятельного эпителия крысы с молекулярной массой 45 кДа, AJ132352; AC004997- гипотетический белок человека, AC004997; RALBP –ретиналь-связывающий белок из японского кальмара, Р49193; SEC14 - фосфатидилхолин/фосфатилинозит-транспортный белок дрожжей, Р24280; -ТТР --токоферол-связывающий белок крысы, Р41034; СRALBPретиналь-связывающий белок мыши, AF084638. Жирным шрифтом выделены аминокислотные остатки, инвариантные в четырех и более последовательностях, серым – остатки, идентичные остаткам р45. Прочерки введены для оптимизации выравнивания. Цифры слева обозначают номера первых остатков в строке последовательности р45.

При сравнении полной аминокислотной последовательности исследуемого белка со структурами, хранящимися в базах данных, существенное сходство выявлено между р45 и белками-переносчиками гидрофобных лигандов, например, ретиналь- и -токоферол-связывающими белками, фосфатидилхолин/фосфатилинозит-транспортным белком дрожжей (Sec14p) (рис. 17).

У всех перечисленных на рис. 17 белков, включая р45, присутствует консервативный фрагмент Lys-Pro-Phe-Leu (у р45 – в положении 206-209). Кроме того, большинство из этих белков имеет в составе лиганд-связывающих участков консервативные остатки Glu184, Phe198, Leu204, Lys216, Ile217 (нумерация аминокислотных остатков приведена для первичной структуры р45). В настоящее время консервативный участок, занимающий 76 – 246 положения полипептидной цепи р45 и характерный для многих липид-переносящих белков, называют «SEC14»-доменом по названию дрожжевого белка Sec14p, в котором он впервые был обнаружен.

Белки, имеющий в своем составе этот домен, также часто называют Sec14pподобными или «SFH» (Sec Fourteen Homology). Этот же домен, идентифицированный у ряда млекопитающих, иногда обозначают как «CRAL_TRIO».

Исходя из полученных данных по аминокислотной последовательности, была рассчитана вторичная структура Sec14p-подобного белка из обонятельного эпителия крысы. Характерное чередование элементов вторичной структуры дало возможность идентифицировать участок 265-381 последовательности цепи белка как GOLD домен (рис. 18), определяющий, согласно литературным данным, белок-белковые взаимодействия.

Рис. 18. Профиль гидрофильности и доменная организация р45 из обонятельного эпителия крысы.

Структура и функции некоторых представителей Sec14p-подобных белков хорошо изучены. Но только состоящий из одного SEC14-домена («истинный») дрожжевой Sec14p, является липид-транспортным. Многие белки этого семейства имеют мультидоменную структуру и эволюционно приспособлены для выполнения множества функций, таких как передача сигналов, регуляция секреции, взаимодействие клеточных компартментов.

2.3. Локализация места синтеза и поиск возможных биологических партнеров рДля определения места локализации р45 был проведен иммуноблотинг водорастворимых белков различных тканей крысы (обонятельный эпителий, трахея, легкие, мозг, печень, мышца, кожа) с использованием кроличьих поликлональных антител против природного р45.

Как и ожидалось, максимальное содержание исследуемого полипептида обнаруживалось в обонятельном эпителии, несколько меньше – в трахее, легких и коже. Эти ткани были использованы для проведения in situ гибридизации с целью выявления места синтеза р45. В качестве зондов для экспериментов по гибридизации были получены [33P]-меченые фрагменты мРНК р45, гомологичные и комплементарные его мРНК (рис. 19).

Рис. 19. Экспрессия мРНК р45 в различных тканях крысы, выявленная методом in situ гибридизации.

Визуализация в «темном поле» срезов тканей обонятельного эпителия (А), трахеи (В), легкого (С) и толстой кожи (D), обработанных меченой антисмысловой и смысловой рибонуклеотидной пробой (левая колонка и правая колонка фотографий, соответственно).

Масштабный отрезок 100 мкм.

Наиболее высокий уровень экспрессии был обнаружен в слое эпителия, содержащем тела обонятельных, опорных и стволовых клеток обонятельного эпителия, апикальном районе трахеи, поверхностном слое мерцательного эпителия бронхов и легких и эпидермисе кожи (рис. 19). Таким образом, было показано, что р45 синтезируется именно в тех тканях, где он выявляется иммуногистохимическими методами и, подобно пероксиредоксину VI (р28), является специфичным для эпителиальных тканей, имеющих контакт с окружающей средой. Высокое содержание Sec14p-подобного белка в этих тканях говорит о его важной роли в обеспечении их нормального функционирования.

Для выяснения функциональной роли р45 в эукариотической клетке в качестве первого этапа исследований был применен один из протеомных подходов – поиск взаимодействующих белков с помощью двугибридной системы.

Наиболее высокое содержание белка было обнаружено в обонятельной выстилке, и, следовательно, исследовать библиотеку кДНК наиболее целесообразно было именно этого органа. Однако с учетом данных по высокому уровню синтеза р45 во всех тканях, контактирующих с кислородом воздуха (в том числе и в легких), а также того, что библиотека кДНК обонятельной выстилки крысы, пригодная для поиска белков-партнеров, коммерчески недоступна, решено было применить для этих целей библиотеку кДНК легких крысы в составе вектора рАСТ2, специально сконструированную для двугибридной системы. В качестве «приманки» при скрининге была использована плазмида pGBT9(p45), содержащая кДНК р45 - полноразмерного Sec14p-подобного белка обонятельного эпителия крысы.

Предварительные эксперименты показали, что р45 сам по себе не активирует репортерные системы HIS3 и lacZ, и поэтому поиск его партнеров может быть осуществлен с помощью двугибридного скрининга. В результате была проанализирована библиотека кДНК из легких крысы представительностью 7х1дрожжевых клонов, полученных в результате трансформации клеток S. cerevisiae Y190 плазмидами pGBT9(p45) и суммарной кДНК из легких крысы, клонированной в составе вектора рАСТ2. Дрожжевые позитивные корны (клонов), отобранные по способности активировать HIS3- и lacZ-репортерные системы, послужили источником кДНК белков, являющихся предположительными партнерами Sec14p-подобного белка.

Была определена частичная нуклеотидная последовательность отобранных кДНК в составе вектора рАСТ2 и проведен поиск гомологичных структур в базе данных GenBank. Среди идентифицированных структур наиболее широко представлены белки, имеющие участки взаимодействия с нуклеиновыми кислотами (транскрипционные факторы, рибосомные, участвующие в транспорте нуклеотидов - всего 13 белков) и, в силу описанных их функциональных свойств, отнесенные нами к разряду «ложноположительных».

Шесть наиболее вероятных и отобранных после анализа их структуры, свойств и локализации, функциональных партнеров р45 представлены в таблице 5. Три из них являются секретируемыми, три – мембранными. Остальные же белки, по-видимому, напрямую не взаимодействуют с р45 и в нашем случае активируют экспрессию репортерных генов напрямую или за счет непрямых метаболических эффектов.

Появление таких «ложноположительных» сигналов является серьезным ограничением метода, и поэтому все обнаруженные взаимодействия должны быть подтверждены, по крайней мере, еще одним независимым экспериментальным подходом.

Функции пяти из предполагаемых партнеров р45 достаточно хорошо изучены, а данные о свойствах трансмембранного белка «Tde1», который впервые был идентифицирован в неопластических клетках различных структур мозга, начинают только появляться.

Из приведенных в таблице 5 белков наиболее интересным кандидатом на роль партнера по взаимодействию с р45 является сурфактантный белок С (SfpC), имеющий в своем составе участок взаимодействия с липидом и находящийся подобно р45 в существенных количествах исключительно в тканях, непосредственно контактирующих с окружающей средой. Путем понижения силы поверхностного натяжения на границе воздух-вода, SfpC обеспечивает стабильность легочных альвеол, и мутации в гене этого белка связаны с серьезными легочными заболеваниями. Как и SfpC и другие сурфактантные белки, Sec14p-подобный белок возможно может принимать участие в формировании примембранного слоя имеющих контакт с окружающей средой клеток, выполняя тем самым их защитную функцию.

Таблица 5. Белки – кандидаты на роль функциональных партнеров Sec14pподобного белка Номер доступа соответ Название белка Функции белка ствующей кДНК в базе данных GenBank и положе ние участка этой кДНК, идентифицированного программой BLAST Белки, секретирующиеся во внеклеточное пространство Защитная; ассоциированный Сурфактантный белок С NM_017342 8-5с липидами белок.

Защитная; модулятор Секретоглобин NM_013051 14-4воспалительных процессов.

Защитная, участвует в Хемокин, Ccl5 хемотаксисе, модулятор NM_031116 1-2воспалительных процессов.

Мембранные белки Компонент -секретазного Активатор 2 пресенилина комплекса, участвующего в NM_172341 194-5человека, Pen2 протеолизе ряда мембранных белков.

Компонент рецепторного комплекса Эндоглин BC029080 2060-25трансформирующего ростового фактора .

Белок 1, дифференцированно Трансмембранный белок с экспрессирующийся в антиапоптотическими XM_215930 535-10неопластических клетках функциями.

различных мозговых структур мыши, TdeПоскольку р45 локализован в обонятельном эпителии, который, контактируя с окружающей средой, является и органом периферической иммунной системы, и тканью, содержащей обонятельные нейроны, то не исключено специфическое участие исследуемого белка в иммунной или/и нервной системах. Тем более, что уже идентифицированы белки, включающие в себя липид-связывающий SEC14домен и участвующие в различных сигналпроводящих каскадах (тирозинфосфатаза PTP-MEG2, нейрофибромин, кайтаксин, калирин).

2.4. Исследование липид-связывающей специфичности р45 из обонятельного эпителия крысы Сравнение аминокислотной последовательности р45 с другими Sec14pподобными белками (рис. 17) позволяет отнести его к группе «ТАР» – белков.

Название группе было дано по первому открытому представителю - -токоферолсвязывающему белку человека (-tocopherol-associated protein). Геном человека содержит три ТАР-подобных гена: hТАР, hТАР2 и hТАР3. Они расположены в пределах 100 кб друг от друга на хромосоме 22q12.1, и сходство между ними составляет 80-90 %. Изучаемый Sec14p-подобный белок обонятельного эпителия крысы является ортологом hТАР2.

Несмотря на подобие липид-связывающих участков, ТАР-белки проявляют большое лигандное разнообразие. Его причины не понятны, но в каждом конкретном случае специфичность связывания, и, следовательно, и механизм функционирования белка в целом, может определяться полярной частью липида, тканевой локализацией белка и его взаимодействием с другими регуляторными молекулами. Помимо -токоферола, для этой группы белков указываются такие лиганды как транс-ретиналь, фосфатидилхолин, сквален, фосфатидилсерин и различные фосфатидилинозитиды. Поэтому следующий этап исследования был посвящен определению лигандной специфичности р45 - Sec14p-подобного белка обонятельного эпителия крысы.

Изучение р45-лигандного взаимодействия на нитроцеллюлозных пластинках С помощью метода изучения белок-липидного взаимодействия на твердой подложке («PLO-assay») в предварительных экспериментах по изучению специфичности р45 было показано, что исследуемый полипептид не взаимодействует с -токоферолом и по данным ТСХ связывается лишь с одной частью общего липидного экстракта выстилки, дающей положительную качественную реакцию на фосфолипиды.

Идентификация фосфолипидного лиганда р45 осуществлялась с помощью PLO-assay на мембране PIP-StripsTM (Echelon, США). Она представляет собой специально армированную нитроцеллюлозную пластинку, на которую нанесены практически все встречающиеся в эукариотических клетках фосфолипиды в количестве по 100 пмоль на одну точку. Обработку мембраны растворами р45 в концентрации 50 и 10 нмоль проводили в двух повторах (рис. 20). Детекцию связавшегося с липидами белка осуществляли иммунохимической реакцией с использованием поликлональных антител к р45 с последующим проявлением комплекса методом хемилюминисценции.

Рис. 20. Исследование липид-связывающей специфичности Sec14p-подобного белка из обонятельного эпителия крысы на нитроцеллюлозных мембранах. Мембраны с набором липидов были обработаны в двух повторах (по 50 (а) и 10 нМ (б)) растворами, содержащими природный или рекомбинантный белки. Использованы следующие сокращения названий фосфолипидов: фосфатидилинозит (PtdIns), фосфатидилинозит-3-монофосфат (PtdIns(3)P), фосфатидилинозит-4-монофосфат (PtdIns(4)P), фосфатидилинозит-5-монофосфат (PtdIns(5)P), фосфатидилинозит-3,4-дифосфат (PtdIns(3,4)P2), фосфатидилинозит-3,5-дифосфат (PtdIns(3,5)P2), фосфатидилинозит-4,5-дифосфат (PtdIns(4,5)P2), фосфатидилинозит-3,4,5трифосфат (PtdIns(3,4,5)P3), фосфатидилэтаноламин (PtdEtNH2), фосфатидилхолин (PtdCho), фосфатидилсерин (PtdSer), лизофосфатидовая кислота (LPA), лизофосфатидилхолин (LPC), сфингозин-1-фосфат (S1P), фосфатидовая кислота (PtdA). (blank) -место для нанесения дополнительного контрольного образца (в нашем случае не наносился).

Здесь необходимо заметить, что для большей убедительности в опытах по идентификации лиганда помимо природного белка использовались также препараты генно-инженерного, с аминокислотной последовательностью, полностью идентичной природной, и специально синтезированного в клетках E.coli для этих целей.

Как видно из рисунка 20 в обоих случаях самую высокую аффинность рпроявлял к PtdIns(3,4,5)P3, хотя при большей концентрации белка положительный сигнал, хотя и в меньшей степени, давали и другие фосфолипиды. При понижении концентрации р45 в инкубационном растворе специфичность взаимодействия возрастала (рис. 20, б), и как выделенный из обонятельного эпителия белок, так и полученный генноинженерным путем связывались практически только с PtdIns(3,4,5)P3.

Изучение взаимодействия р45 с фосфатидилинозит-3,4,5-трифосфатом В биохимических исследованиях широко используются твердые подложки на основе нитроцеллюлозы как место образования липид-белковых или белокбелковых комплексов. Но, учитывая возможность неспецифического взаимодействия белка с нитроцеллюлозой, а также литературные данные о выявлении других фосфолипидов в качестве лигандов Sec14p-подобного семейства, было решено подтвердить взаимодействие р45 и PtdIns(3,4,5)P3 с помощью метода коседиментации.

Липосомы были приготовлены из смеси PtdEtNH2 с PtdCho (4:1) в органических растворителях, добавлением к ней необходимого количества трифосфата. К этим липосомам, содержащим 0, 0,25 или 0,5 % PtdIns(3,4,5)P3, добавляли водный раствор р45, специально выделенного для этих целей из обонятельного эпителия крысы. Полученную суспензию энергично встряхивали, а затем с помощью центрифугирования разделяли на липидную (осадок) и водорастворимую (супернатант) фракции. Анализ и идентификацию связавшегося с трифосфатом белка осуществляли с помощью иммуноблоттинга с хемилюминесцентным детектированием (рис. 21). Для повышения достоверности анализа выявление р45 в белок-липидном комплексе было проведено с помощью моноклональных антител (в частности, мАТ 1F4C1), специально полученных для этих целей.

Как следует из рисунка 21, в случае отрицательного контроля, когда липосомы не содержали PtdIns(3,4,5)P3, белок обнаруживался только в супернатанте, т.е. связывания р45 с липосомами не наблюдалось. При увеличении содержания трифосфата в липосомах до 0,5 % происходило явное образование комплекса белка с липидом, и после его осаждения центрифугированием р45 обнаруживался уже в осадке. Таким образом, было получено еще одно доказательство специфического связывания р45 с PtdIns(3,4,5)P3.

р45 с о с о с о 0 % 0,25 % 0,50 % Содержание PtdIns(3,4,5)P3 в липосомах Рис. 21. Иммуноблот-анализ связывания р45 обонятельного эпителия крысы с PtdIns(3,4,5)Pпри его различном содержании в липосомах с использованием мАТ 1F4C1. Буквами «о» и «с» обозначены фракции супернатантов и осадков. Концентрация мАТ 1F4C1 составляла 1,мкг/мл, разведение вторичных АТ – 1:5000. Стрелкой указано положение р45.

Вышеизложенные методы нахождения специфичных лигандов липидпереносящих белков, по существу, указывают только на сам факт связывания полипептида с лигандом, но способность удерживать лиганд, т.е.

транспортная активность белковой молекулы при этом не демонстрируется.

Опыты по выявлению функциональной активности транспортеров обычно проводятся с использованием метки как в составе липида, так и в составе акцепторных липосом. Введение метки обеспечивает меры контроля неспецифического переноса, так как помещенные в модельных экспериментах в одну емкость донорные и акцепторные мицеллы могут контактировать.

В целях избегания использования метки (для удешевления экспериментов и предотвращения стерических затруднений при связывании, неизбежно возникающих при введении в молекулу лиганда дополнительных реперов) был разработан новый подход изучения липид-белковых взаимодействий in vitro, позволяющий определять транспортную активность белка. Метод можно классифицировать как вариант распределительной трехфазной хроматографии, включающей две неподвижные, не контактирующие между собой фазы («донорную» и «акцепторную») и одну подвижную. Исследуемый белок, растворенный в водной подвижной фазе, с помощью насоса прокачивается через два заполненных носителями резервуара и может осуществлять доставку специфического липида в акцепторный липидный слой. Переносимый липид идентифицируется в липидных экстрактах акцепторного слоя носителя и в подвижной фазе. Техническая реализация метода предусматривает использование двух резервуаров, содержащих используемые в качестве твердой подложки для полимерного слоя стеклянные бусинки сферической формы (рис. 22).

Рис. 22. Схема метода изучения липид-белковых взаимодействий. Д-резервуар, содержащий донорную фазу, а А-акцепторную. эД, эА и эВ –липидные фракции экстрактов Д, А и подвижной водной фазы В, соответственно. Показаны результаты обнаружения PtdIns(3,4,5)Pв липидных экстрактах эА, эД и эВ (а). Экстракты наносили на нитроцеллюлозный фильтр и обрабатывали раствором р45 в SET-буфере (30 нМ) с дальнейшим проявлением белка хемилюминисцентным методом. В нижней части рисунка приведен масс-спектр липидного экстракта эА (б). На выноске справа часть масс-спектра с пиком, соответствующим фосфатидилинозиттрифосфату, показана крупно.

На их поверхности создается слой гидрофильного полимера. Оставшееся свободным от бусин пространство в каждом резервуаре заполняется специальным раствором липидов в смеси органических растворителей, один из которых смешивается с водой, а другой нет (метанол:хлороформ 1:4). Раствор для резервуара Д в наших экспериментах содержал PtdCho и PtdIns(3,4,5)P3 в соотношении 10:1. Раствор для А только PtdCho.

Липидный слой формируется на границе раздела фаз воды и органического растворителя. После нанесения липидов и формирования липидных слоев каждую часть системы независимо промывали 10 объемами Трис-НCl (pH 7,4) буферного раствора, содержащего сахарозу и EDTA («SET-буфер»). Затем обе части соединяли через пористый фильтр, предотвращающий непосредственный контакт бусин. В ходе эксперимента через собранную систему пропускали 50 нМ раствор природного Sec14p-подобного белка. Этот SET-буферный раствор представлял собой подвижную фазу «В». Направление циркуляции подвижной фазы на приведенной схеме (рис. 22) показано черными стрелками. Затем водную фазу сливали и разбирали систему. Предварительно промытые бусины, заполнявшие резервуары А и Д, а также собранную водную фазу В экстрагировали по методу Фолча. Полученные таким образом липидные фракции (обозначенные эА, эД, эВ) исследовали с помощью PLO-assay, используя для детекции PtdIns(3,4,5)P3 связывающийся с ним р45. Обнаружение белка на подложке осуществляли с помощью АТ. Как показано на рис. 22, в случае отрицательных контролей (когда подвижная фаза не содержала Sec14pподобный белок, либо когда вместо него раствор содержал 50 нМ BSA) в липидных экстрактах эВ и эА PtdIns(3,4,5)P3 не обнаруживался.

Условия точной масс-спектрометрической идентификации методом MALDI-TOF микроколичеств переносимого лиганда во фракциях эВ и эА были разработаны с участием к.б.н. В.Е. Третьякова (ФГУ НИИ ФХМ).

Таким образом, на примере исследования транспортной активности рбыла продемонстрирована применимость новой методики и подтверждено, что гидрофобным лигандом р45 - Sec14p-подобного белка обонятельного эпителия является PtdIns(3,4,5)P3.

2.5. Экспрессия кДНК Sec14p-подобного белка и его фрагментов в клетках COS-1, колокализация белка и липидного лиганда Ранее было предположено, что в обонятельном эпителии р45 локализован в секреторных гранулах бокаловидных клеток и в прилегающем слое слизи, окружающей обонятельный эпителий. Однако из этих исследований не было ясно, является ли р45 действительно активно секретируемым или он пассивно высвобождается при разрушении назальных клеток. Обычно секретируемые белки синтезируются в виде предшественников, содержащих отщепляемый Nконцевой сигнальный пептид с характерным аминокислотным составом, однако такая последовательность в цепи р45 не была обнаружена. Дальнейшие исследования по изучению внутриклеточной локализации белка и его секреторных путей были проведены совместно с проф. Т. Мустелиным в Раковом центре Института Бурхама (Калифорнийский университет, США) с помощью конфокальной микроскопии.

Рис. 23. Иммуноблоттинг клеточного лизата (дорожки 1 и 2) и культуральной среды (дорожки 3 и 4) COS-1 клеток, трансфецированных конструкциями pEF3HA_GOLD (дорожки 1и 3) и pEF3HA_SEC14 (дорожки 2 и 4) Для решения этого вопроса фрагменты кДНК, кодирующие отдельные домены (SEC14 и GOLD) Sec14p-подобного белка, были экспрессированы в эукариотических клетках (клетки COS-1). В этих экспериментах были использованы генно-инженерные конструкции на основе экспрессирующего вектора для животных клеток pEF3HA. Полученные с его помощью продукты экспрессии имеют в своем составе НА-эпитоп (Anti-influenza Hemagglutinin) и могут идентифицироваться с помощью мАТ. Для детекции НА-эпитопа под конфокальным микроскопом также коммерчески доступны мАТ, конъюгированные с флуоресцентным красителем тетраметилродаминизотиоцианатом (TRITC, красное окрашивание).

Клетки COS-1 были трансфецированы конструкциями pEF3HA_GOLD и pEF3HA_SEC14. После наращивания клеток белковые продукты, кодируемые этими конструкциями, были обнаружены и в клетках, и в среде культивирования.

Результаты идентификации нарабатываемых пептидов приведены на рисунке 23.

Поскольку в культуральной среде присутствовал только SEC14-фрагмент белка, был сделан вывод: экстрацеллюлярная секреция исследуемого белка определяется его липид-связывающим доменом, который так же хорошо может секретироваться, как и полноразмерная цепъ.

Внутриклеточная локализация р45 устанавливалась с помощью экспериментов с конструкцией, включающей в себя полноразмерную кДНК р(pEF3HA_p45) и «пустой» вектор pEF3HA. Клетки, несущие эти конструкции, были иммунологически окрашены и проанализированы под конфокальным микроскопом (рис. 24, а). В случае пустого вектора (рис. 24 а, верхняя панель) экспрессии р45 не наблюдалось, но полипептидная цепь, включающая в себя последовательность р45 и НА-эпитоп (НА_р45), легко идентифицировалась во внутриклеточных везикулах, мембрано-ассоциированных везикулярных структурах и во внеклеточном пространстве.

Присутствие гибридного белка с соответствующей расчетной молекулярной массой (48192 Да) также было подтверждено иммуноблоттингом с помощью мАТ к НА-эпитопу и в культуральной среде, и в клеточном лизате.

Рис. 24. Эндогенная локализация р45 в гранулярных цитоплазматических структурах и внеклеточном пространстве COS-1 клеток. (а) - Конфокальная микроскопия клеток, трансфецированных pEF3HA (верхняя панель) или pEF3HA_p45 (нижняя панель) и окрашенных (красный цвет) мАТ анти-НА, конъюгированным с TRITC. Правая колонка – контрастная микроскопия для определения областей окрашивания. (b)- Конфокальная микроскопия COS-1 клеток, котрансфецированных GFP-EEA1-(FYVE)2 (зеленый цвет) и pEF3HA_p45, окрашенных как (а). (c) – Конфокальная микроскопия COS-1 клеток, трансфецированных pEF3HA_p45, с двойным иммуноокрашиванием карбоксипептидазы Е и НА_р45 первичными мАТ, а затем конъюгированными с зеленым или красным красителями вторичными АТ. ДНК окрашивалась диамидинофенилиндолом (DAPI), и нижняя правая панель демонстрирует совмещение этих трех цветов.

Следующее доказательство присутствия внутриклеточного Sec14рподобного белка именно в секреторных везикулах было получено в экспериментах по совместной экспрессии в клетках COS-1 р45 и гибридной полипептидной цепи, включающей в себя зеленый флуоресцентный белок (GFP) и два тандемных липидсвязывающих « FYVE»-доменов белка ЕЕА1- маркера ранних эндосом. Специфическим лигандом белка ЕЕА1 является фосфатидилинозит-3-монофосфат, самое высокое содержание которого наблюдается в эндосомах и секреторных гранулах. Также, но в заметно меньших количествах, PtdIns(3)P присутствует в мембранах аппарата Гольджи и плазматической мембране. На рисунке 24 (b) видно, как в трансфецированных клетках интенсивное красное флуоресцентное окрашивание внутривезикулярного р45 обрамляется зеленым цветом. Котрансфекция клеток также выявила существование и более мелких меченых GFP-EEA1-(FYVE)2 везикул, где р45 не визуализируется (лизосомы и эндосомы ?). Интенсивное зеленое окрашивание ядра клетки является известным фактом, обычно возникающим при использовании конструкций с GFP, имеющим тенденцию к накапливанию в ядре.

В подтверждение того, что внутриклеточные образования, содержащие р45, действительно являются секреторными везикулами, на этом же рисунке 24 (с) приведены данные по колокализации р45 и карбоксипептидазы Е – специфичного клеточного маркера секреторных везикул.

Таким образом, из этих экспериментов можно заключить, что рсинтезируется в эукариотических клетках, транслоцируется в аппарат Гольджи и затем упаковывается в секреторные везикулы, большинство из которых находится в цитозоле и предназначаются для экзоцитоза («secretory vesicle» на рис. 24 (b). Также необходимо отметить, что внеклеточная локализация гибридного белка HA_p45, наблюдаемая при каждой трансфекции, («extracellular, рис. 24 (b)», скорее всего, определяется свойствами самого р45, а не НА-эпитопа, так как известно множество внутриклеточных белков, локализацию которых в клетке устанавливали с помощью конструкций на основе вектора pEF3HA.

Принимая во внимание широкое представление р45 в слизи, покрывающей эпителий, можно с уверенностью утверждать, что секреция исследуемого белка есть проявление его физиологической функции в клетке.

Совместное присутствие р45 и PtdIns(3,4,5)P3 in vivo было подтверждено экспериментами по трансфекции клеток COS-1 плазмидой pEF3HA_р45 с последующим двойным иммуноокрашиванием мАТ анти- PtdIns(3,4,5)P3 и анти-НА (рис. 25). Как видно из этого рисунка, колокализация белка с липидом в основном наблюдается внутри секреторных везикул, в меньшей степени – в плазматической мембране и внеклеточном пространстве, что не удивительно, учитывая присутствие детергента в растворе для окрашивания.

Рис. 25. Колокализация Sec14p-подобного белка и PtdIns(3,4,5)P3. Конфокальная микроскопия трех независимых образцов (горизонтальные ряды) COS-1 клеток, трансфецированных конструкцией pEF3HA_p45 и дважды обработанных мАТ: первоначально к PtdIns(3,4,5)P(зеленое окрашивание, второй вертикальный ряд), а затем к НА-эпитопу (красное окрашивание, первый вертикальный ряд). Совмещение изображений (третий вертикальный ряд, золотистое окрашивание) демонстрирует совместную локализацию белка и липида.

Изображения, полученные при контрастной микроскопии (четвертый вертикальный ряд), дают возможность оценить области локализации.

Помимо секреторных везикул исследуемый белок проявлялся и в пузырьках пространства транс-Гольджи (рис. 24 (b)). Поэтому было решено проверить совпадение клеточной локализации р45 и гибридного белка, несущего в своем составе (помимо GFP) плекстриновый домен (РН) Btk-киназы и являющегося цитозольным маркером PtdIns(3,4,5)P3 (данные не приведены). При анализе котрансфецированных клеток совпадений окрашивания HA_р45 и GFP-Btk-PH не выявлено. Таким образом, можно сделать вывод, что Sec14p-подобный белок находится в комплексе с фосфатидилинозиттрифосфатом только в секреторных везикулах, но клеточным цитозольным маркером для этого липида он не является.

PtdIns(3,4,5)P3 является ключевым посредником самых разнообразных сигнальных путей, запускающих и регулирующих такие клеточные процессы, как дифференцировка, хемотаксис, эндоцитоз, транспорт и гомеостаз глюкозы.

Но означает ли взаимодействие Sec14p-подобного белка с фосфолипидом его вовлечение в один из этих процессов или этот лиганд необходим для реализации какой-либо собственной активности, пока остается неясным.

Обнаружение Sec14p-подобного белка в секреторных везикулах и культуральной среде – это первое известное автору сообщение о возможной секреции липидных транспортеров (LTP) млекопитающих во внеклеточное пространство. Однако заметим, что в мире растений это явление уже известно.

Поверхность контактирующих с атмосферой эпидермальных клеток растений покрыта кутикулярной пленкой, в формировании которой и принимают участие секреторные LTP (nsLTP). Эта пленка регулирует водный режим и защищает листья от повреждений и проникновения инфекции. Как было показано недавно (Cameron K.D. et al., 2006), в условиях водного дефицита усиление экспрессии гена nsLTP листьев табака и увеличение плотности кутикулярной пленки происходит синхронно. Таким образом, уместно предположить, что функционирование Sec14p-подобного белка в клетках, имеющих непосредственный контакт с атмосферой, может быть как-то связано с регулированием распределения или доступности гидрофобных лигандов в экстраклеточной области, что, в конечном счете, может приводить к структуризации слизистого барьера носоглотки.

ВЫВОДЫ 1. Идентифицирован и выделен в гомогенном состоянии из обонятельной выстилки крысы новый секреторный белок, выявляющийся при электрофоретическом анализе в виде мономера с кажущейся молекулярной массой 28 кДа (р28) и обладающий протекторным действием в металлокислительных системах.

2. Установлена нуклеотидная последовательность кДНК р28.

Кодирующая область кДНК содержит 672 п.о. и соответствует белку с вычисленной массой 24680 Да. Реконструирована полная аминокислотная последовательность р28, включающая в себя 223 остатка.

3. Сравнение первичной структуры р28 с последовательностями других белков показало, что он содержит участок, подобный последовательности P39xDFTPVCxTE49, включает в себя единственный остаток Cys (Cys46) и принадлежит к подсемейству 1-Cys-содержащих тиол-специфических антиоксидантов или пероксиредоксинов VI. На основании этого сделано предположение, что основной функцией р28 является защита клеток эпителия от повреждений, вызываемых действием активных форм кислорода.

4. Показано, что, несмотря на имеющийся в составе Prx VI участок AsnThrThr, белок не гликозилирован; отсутствие посттрансляционной модификации имеет важное значение для проявления ферментом функциональной активности.

5. Разработаны условия получения высокоактивных генно-инженерных аналогов Prx VI человека и осуществлено сравнение их протекторных свойств с природным белком.

6. Идентифицирован и выделен в гомогенном состоянии из обонятельной выстилки крысы новый секреторный белок, выявляющийся при электрофоретическом анализе в виде мономера с кажущейся молекулярной массой 45 кДа (р45).

7. Установлена полная нуклеотидная последовательность кДНК р45.

Кодирующая область кДНК содержит 1200 п.о. Реконструирована полная аминокислотная последовательность р45, включающая в себя 400 остатков.

8. Определена частичная аминокислотная последовательность белка, подобного по физико-химическим свойствам р45 и сопутствующему ему практически на всех стадиях хроматографической очистки (YM-1). Впервые показано присутствие в обонятельной выстилке млекопитающих хитиназы YM-1.

9. Выявлена гомология между аминокислотными последовательностями р45 и липид-переносящими белками, несущими в своем составе CRAL/TRIO- или Sec14p-подобный домен. Показано, что наибольшая концентрация робнаруживается в эпителиальных тканях, имеющих непрерывный контакт с окружающей средой.

10. В экспериментах с препаратами природного и рекомбинантного р45 с помощью блоттинга на нитроцеллюлозных пластинках и на искусственных липосомах, а также с помощью специально разработанной методики изучения липидного транспорта, впервые показано, что специфическим лигандом Sec14pподобного белка обонятельного эпителия млекопитающих является фосфатидилинозит-3,4,5-трифосфат.

11. Осуществлена экспрессия Sec14p-подобного белка в эукариотических клетках COS-1. Анализом трансфецированных клеток показано, что исследуемый белок действительно является секреторным, и что секреция есть проявление его физиологической функции.

12. Впервые продемонстрировано участие Sec14p-подобного белка во внеклеточном транспорте и присутствие фосфатидилинозит-3,4,5-трифосфата у высших эукариот во внеклеточной среде. В связи с этим высказано предположение о вовлечении исследуемого белка в транспорт фосфатидилинозитидов и образование защитного слоя слизи на обонятельном эпителии.

Основные результаты диссертации изложены в следующих работах Обзоры 1. Липкин В.М., Шуваева Т.М., Розынов Б.В. Анализ химического строения белка; в кн.

«Проблема белка», т. 1, под ред. В.М. Липкина. М: Наука, 1995, стр. 291-354.

2. Липкин В.М., Шуваева Т.М. Белки; в кн. «Большая Российская энциклопедия», т. 3, М.: Большая Российская энциклопедия, 2005, стр. 211-215.

Статьи (в журналах, рекомендованных ВАК и включенных в систему цитирования Web of Science) 3. Пешенко И.В., Новоселов В.И., Евдокимов В.А., Попов В.И., Николаев Ю.В., Шуваева Т.М., Липкин В.М., Фесенко Е.Е. Выделение и биохимический анализ нового секреторного 28-кДа белка из обонятельного эпителия крысы. Сенсорные системы 1996, 10 (3), 97-109.

4. Peshenko I.V., Novoselov V.I., Evdokimov V.A., Nikolaev Yu.V., Shuvaeva T.M., Lipkin V.M., Fesenko E.E. Novel 28-kDa secretory protein from rat olfactory epithelium. FEBS Lett. 1996, 381 (1), 12-14.

5. Peshenko I.V., Novoselov V.I., Evdokimov V.A., Nikolaev Yu.V., Kamzalov S.S., Shuvaeva T.M., Lipkin V.M., Fesenko E.E. Identification of a 28 kDa secretory protein from rat olfactory epithelium as a thiol-specific antioxidant. Free Radical Biology & Medicine 1998, 25 (6), 654-659.

6. Андреева С.Г., Меркулова М.И., Шуваева Т.М., Новоселов В.И., Пешенко И.В., Новоселов С.В., Фесенко Е.Е., Липкин В.М. Структурные исследования секреторного 28-кДа белка из обонятельного эпителия крысы. Биоорган. химия 1998, 24 (11), 816-821.

7. Novoselov S.V., Peshenko I.V., Popov V.I., Novoselov V.I., Bystrova M.F., Evdokimov V.A., Kamzalov S.S., Merkulova M.I., Shuvaeva T.M., Lipkin V.M., Fesenko E.E. Localization of 28-kDa peroxiredoxin in rat epithelial tissues and its antioxidant properties. Cell Tissue Res. 1999, 298 (3), 471-480.

8. Shuvaeva T.M., Andreeva S.G., Merkulova M.I., Novoselov V.I., Peshenko I.V., Fesenko E.E., Lipkin V.M. Novel 28 kD and 45 kD olfactory enzymes:structure and functions. J. Neurochemistry 1999, 73 (suppl.), S46.

9. Меркулова М.И., Шуваева Т.М., Радченко В.В., Янин В.А., Бондарь А.А., Софин А.Д., Липкин В.М. Рекомбинантный пероксиредоксин человека: получение и протекторные свойства in vitro. Биохимия 2002, 67 (11), 1496-1501.

10 Radchenko V.V., Nekrasov A.N., Shuvaeva T.M., Merkulova M.I., Lipkin V.M. Analysis of informational structure of protein amino acid sequences and obtaining large biologically active peptides of human 1-Cys peroxyredoxin. J. Peptide Sci. 2004, 10 (8), 258.

11. Merkulova M.I., Andreeva S.G., Shuvaeva T.M. Novoselov S.V., Peshenko I.V., Bystrova M.F., Novoselov V.I., Fesenko E.E., Lipkin V.M. A novel 45 kDa secretory protein from rat olfactory epithelium: primary structure and localisation. FEBS Lett. 1999, 450 (1-2), 126-130.

12. Меркулова М.И., Радченко В.В., Ильницкая Е.В., Шуваева Т.М., Липкин В.М. Протеомный подход к изучению функций Sec14р-подобного белка р45. Биоорган. химия 2005, 31 (3), 280287.

13. Радченко В.В., Шуваева Т.М., Ильницкая Е.В., Третьяков В.Е., Липкин В.М. Новый метод изучения липидного транспорта in vitro: белок с молекулярной массой 45 кДа из обонятельного эпителия крысы – специфический переносчик фосфатидилинозит-3,4,5-трифосфата. Биоорган.

химия 2005, 31 (4), 445-448.

14. Merkulova M., Huynh H, Radchenko V., Saito K., Lipkin V., Shuvaeva T., Mustelin T. Secretion of the mammalian Sec14p-like phosphoinositide-binding p45 protein. FEBS Journal 2005, 272 (10), 5595-5605.

15. Радченко В.В., Меркулова М.И., Шуваева Т.М., Симонова Т.Н., Бондарь А.А., Липкин В.М.

Функциональная экспрессия Sec14р-подобного белка с молекулярной массой 45 кДа из обонятельного эпителия крысы. Биохимия 2005, 70 (12), 1631-1638.

16. Ильницкая Е.В., Шамборант О.Г., Радченко В.В., Шуваева Т.М., Липкин В.М. Связывание Sec14-подобного белка с молекулярной массой 45 кДа из обонятельного эпителия крысы с фосфатидилинозит-3,4,5-трифосфатом в липосомах. Биоорган. химия 2006, 32 (3), 335-336.

17. Nekrasov A. N., Radchenko V.V., Shuvaeva T.M., Novoselov V.I., Fesenko E.E., Lipkin V.M. The novel approach to the protein design: active truncated forms of human 1-Cys peroxiredoxin. Journal of Biomolecular Structure & Dynamics 2007, 24 (5), 455-462.

Материалы конференций 18. Шуваева Т.М., Андреева С.Г., Меркулова М.И., Пешенко И.В., Новоселов В.И., Фесенко Е.Е., Липкин В.М. Новые секреторные белки обонятельного эпителия крысы. IV Чтения, посвященные памяти академика Ю.А. Овчинникова, Москва 1998. Тез. докл. и стенд. сообщ., С. 33.

19. Новоселов В.И., Пешенко И.В., Попов В.И., Новоселов С.В., Быстрова М.Ф., Евдокимов В.А., Камзалов С.С., Меркулова М.И., Шуваева Т.М., Липкин В.М., Фесенко Е.Е. Локализация пероксиредоксина с молекулярной массой 28 кДа в эпителиальных тканях крысы и его антиоксидантные свойства. II Съезд биофизиков России, Москва 1999. Тез. докл. и стенд.

сообщ., XIII.1.9.

20. Novoselov V.I., Peshenko I.V., Bystrova M.F., Evdokimov V.J., Novoselov S.V., Kamzalov S.S., Shuvaeva T.M., Merkulova M.I., Andreeva S.G., Lipkin V.M., Fesenko E.E. Novel secretory proteins from rat epithelium tissues. INTAS Symposium “Microbial and Cellular Systems for Pharmacology, Biotechnology, Medicine and Environment”, Moscow 1999. Proceeding book, P. 32.

21. Merkulova M.I., Novoselov S.V., Peshenko I.V., Novoselov V.I., Shuvaeva T.M., Lipkin V.M. The novel transfer protein from rat olfactory epithelium. NATO-FEBS Meeting “Protein, lipid and membrane traffic: pathways and targeting”, Cargese-Corsica-France 1999, Abstr.

22. Шуваева Т.М., Меркулова М.И., Новоселов В.И., Бондарь А.А., Радченко В.В., Липкин В.М.

Структурно-функциональное изучение пероксиредоксина VI и создание на его основе лекарственных препаратов. Х Международная конф. «Новые информационные технологии в медицине и экологии», Украина, Крым, Гурзуф 2002. Тез. докл., С. 345.

23. Радченко В.В., Меркулова М.И., Евдокимов В.А., Барышникова Л.М., Шуваева Т.М., Липкин В.М. Получение в прокариотических системах экспрессии рекомбинантного белка кДа из обонятельного эпителия крысы и гомологичного ему белка 45 кДа человека. Х Международная конф. «Новые информационные технологии в медицине и экологии», Украина, Крым, Гурзуф 2002. Тез. докл., С. 376-377.

24. Меркулова М.И., Huynh H., Радченко В.В., Липкин В.М., Шуваева Т.М., Mustelin T.

Секреция SEC14р-подобного белка из обонятельного эпителия крысы. VII Чтения, посвященные памяти академика Ю.А. Овчинникова, Москва 2004. Тез. докл. и стенд. сообщ., С. 52-53.

25. Радченко В.В., Меркулова М.И., Шуваева Т.М., Липкин В.М. Фосфатидилинозитсвязывающий домен SEC14р-подобного белка из обонятельного эпителия крысы. VII Чтения, посвященные памяти академика Ю.А. Овчинникова, Москва 2004. Тез. докл. и стенд. сообщ., С. 54.

26. Nekrasov A.N., Radchenko V.V., Merkulova M.I., Shuvaeva T.M., Lipkin V.M. Expression of recombinant truncated forms of human peroxiredoxin (1-Cys PrxVI) designed using a structuralinformation analysis of its amino acid sequence. 7th Int. Symp.on Biomol. Chem., Sheffield 2004, The United Kingdom, Abstr., P. 24.

27. Radchenko V.V., Nekrasov A.N., Shuvaeva T.M., Merkulova M.I., Lipkin V.M. Analysis of informational structure of protein amino acid sequences and obtaining large biologically active peptides of human 1-Cys peroxyredoxin. J. Peptide Sci. 2004, 10 (8), 258.

28. Radchenko V.V., Nekrasov A.N., Shuvaeva T.M., Lipkin V.M. Information structure analysis of protein sequences. Design and purification of recombinant truncated forms of human 1-Cys peroxiredoxin. Moscow Conference on computational molecular biology, Moscow 2005, Abstr. P.

311-313.

29. Шуваева Т.М., Новоселов В.И., Радченко В.В., Ильницкая Е.В., Фесенко Е.Е., Липкин В.М.

Новые белки обонятельного эпителия млекопитающих. VIII Чтения, посвященные памяти академика Ю.А. Овчинникова, Москва 2006. Тез. докл. и стенд. сообщ., С. 9.

30. Radchenko V.V., Il’nitskaya E.V., Shuvaeva T.M., Tret’yakov V.E., Lipkin V.M. A new method for lipid transport studying in vitro: The tool for identification unknown lipid binding proteins and their hydrophobic ligands determining lipid metabolism pathology. Special meeting “New concepts in lipidology: from lipidomics to disease”, Noordwijkerhout 2006, The Netherlands. Abstr., P. 109.

Патенты 31. Липкин В.М., Шуваева Т.М., Радченко В.В., Меркулова М.И., Новоселов В.И., Фесенко Е.Е.

Рекомбинантная плазмидная ДНК pET23-a(+)PrxVIhum178, кодирующая N-концевой фрагмент пероксиредоксина VI человека, и штамм E. coli BL21/DE3/pET23-a(+)/PrxVIhum1– продуцент N-концевого фрагмента пероксиредоксина VI человека. Патент РФ № 2250262, 20.04.2005.

32. Fesenko E.E., Novoselov V.I., Yanin V.A., Lipkin V.M., Shuvaeva T.M. Antioxidant pharmaceutical compound, method for producing polypeptide and method of cure. PCT WO 2004/043485 A1, 27.05.2004.

33. Радченко В.В., Шуваева Т.М., Ильницкая Е.В., Липкин В.М. Способ определения липидпереносящей способности белков. Патент РФ № 2302426, 10.07.2007.






© 2011 www.dissers.ru - «Бесплатная электронная библиотека»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.