WWW.DISSERS.RU

БЕСПЛАТНАЯ ЭЛЕКТРОННАЯ БИБЛИОТЕКА

   Добро пожаловать!


На правах рукописи

ДМИТРИЕВ АНДРЕЙ ВИКТОРОВИЧ

СТРУКТУРНЫЕ И ФУНКЦИОНАЛЬНЫЕ ХАРАКТЕРИСТИКИ ПРИРОДНЫХ И ХИРАЛЬНО МОДИФИЦИРОВАННЫХ МОДЕЛЬНЫХ ИОННЫХ КАНАЛОВ

Специальность 03.00.02 – биофизика

АВТОРЕФЕРАТ

диссертации на соискание ученой степени доктора физико-математических наук

Москва – 2009

Работа выполнена на кафедре гуманитарных и естественнонаучных дисциплин Филиала Орловской региональной академии государственной службы в г. Липецке

Научный консультант: доктор физико-математических наук, профессор Твердислов Всеволод Александрович Официальные доктор физико-математических наук оппоненты: Быстров Владимир Сергеевич доктор физико-математических наук Ермаков Юрий Александрович доктор биологических наук Лопина Ольга Дмитриевна

Ведущая организация: Институт биохимической физики имени Н.М. Эмануэля РАН

Защита состоится « 16 » апреля 2009 года в 1530 часов на заседании Совета по защите диссертаций Д 501.002.11 по физико-математическим наукам при Московском государственном университете им. М.В. Ломоносова по адресу: Ленинские горы, Москва, ГСП-1, 119991, МГУ, Физический факультет, кафедра биофизики, ауд. 5-19.

С диссертацией можно ознакомиться в библиотеке Физического факультета МГУ им. М.В. Ломоносова

Автореферат разослан « ___ » _________________ 2009 года

Ученый секретарь Диссертационного совета Д 501.002.доктор физико-математических наук Г.Б. Хомутов

ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ



Актуальность работы. Перенос ионов через биологические мембраны является одним из наиболее важных процессов, происходящих в живых клетках. Обеспечивая общую термодинамическую неравновесность клетки, он играет основополагающую роль в таких важнейших физиологических процессах, как преобразование энергии, поддержание постоянного химического состава внутренней среды, регуляция и рецепция, биологическая подвижность, распространение импульса и др. Так как липидный бислой мембраны создает исключительно высокий энергетический барьер для прохождения ионов, то осуществление ионного транспорта требует наличия специализированных макромолекулярных структур, которые могли бы существенно уменьшить этот энергетический барьер. Именно эту роль выполняют ионные насосы, ионные каналы, ионообменники, антибиотики. Среди различных ион-транспортных систем ионные каналы характеризуются относительно высокой скоростью транспорта в сочетании с высокой селективностью к транспортируемым ионам.

Центральной проблемой в исследовании физических свойств ионных каналов является установление связи между их структурой и функциями. Появление экспериментальной информации по структуре ионных каналов стимулировало разработку различных теоретических подходов к исследованию механизмов переноса ионов в каналах, основывающихся, прежде всего, на уравнениях молекулярной и броуновской динамики, теории абсолютных скоростей реакций Эйринга и теории диффузии Пуассона-Нернста-Планка. Вместе с тем прогресс в теоретическом исследовании механизмов переноса ионов существенно затруднен из-за отсутствия единого подхода к оценке энергетических профилей ионов в канале, которые, в явном или неявном виде, включены во все вышеуказанные уравнения. Следствием этого является физически неоднозначная калибровка параметров энергетических профилей и уравнений для расчета функциональных характеристик каналов, таких как проводимости, ионные токи, вольтамперные характеристики и отношения коэффициентов проницаемостей для различных ионов.

Ионная асимметрия в содержании важнейших катионов во внутренней среде клеток относительно внешней среды, формируемая при участии ионных насосов и ионных каналов, непосредственным образом связана с другой фундаментальной асимметрией – хиральной асимметрией важнейших биомолекул во всей биосфере, которая проявляется в построении нуклеиновых кислот из Dэнантиомеров (дезокси)рибозы, а синтезируемых в рибосомах белков – из Lэнантиомеров аминокислот. Так существуют близкие значения свободной энергии, необходимой для формирования хирально чистых биополимеров и ионной асимметрии клеток (Твердислов и Яковенко, 2003).

Рассматривая общие структурные и функциональные особенности живой клетки, целесообразно выделить два аспекта нарушения зеркальной симметрии биомолекул. Во-первых, это эволюционно востребованная необходимость гомохиральности, во-вторых – эволюционно закрепившийся знак хиральности.

Физико-химические и биологические основы гомохиральности биополимеров в последнее время изучены достаточно разносторонне (Аветисов, Гольданский, 1996; Чернавский, 2000; Твердислов, Яковенко, 1992, 2008). Так гомохиральность белков и нуклеиновых кислот определяет их стереоспецифичность – необходимое условие матричного синтеза, обусловливает стабильность их структур, обеспечивающих их функционирование. Для биохимических преобразований гомохиральных соединений требуется значительно меньший набор ферментов, чем для таких же преобразований гетерохиральных соединений. Основы механизмов сопряжения ионной и хиральной асимметрий рассмотрены в работах Твердислова, Яковенко, Дмитриева (1988 - 2008).

Несмотря на значительные успехи, достигнутые в области исследования гомохиральности биополимеров, физико-химическое и биологическое основы того, что белки-ферменты и нуклеиновые кислоты имеют строго определенный знак хиральности, остаются недостаточно выясненными. Интерес к этой проблеме усиливается тем, что, согласно гипотезам спонтанной дерацемизации и решающей роли глобального фактора преимущества (Гольданский и Кузьмин,1989), повторение всей совокупности событий, приведших к появлению хиральной чистоты, равновероятно способно привести к такой гипотетической биосфере, которая использовала бы D-аминокислоты и L-сахара.

Следует отметить, что, помимо сахаров и аминокислот, другие хиральные компоненты клетки в определенных случаях могут встречаться как в одной, так и в другой изомерной форме. В некоторых бактериях обнаружены L-сахара и Dаминокислоты. D-аминокислоты достаточно широко распространены в живой природе и, более того, входят в состав ряда биологически значимых коротких олигопептидов. Встречаются бактерии, которые содержат D-глютаминовую кислоту и D-Ala в своих клеточных стенках, а в организме человека вырабатывается в качестве нейромедиатора D-Ser. Некоторые пептидные антибиотики, а также плазма крови высших организмов, имеют в своем составе D-аминокислоты.

Некоторые термофилы используют высокие концентрации D-Ala в качестве осморегулятора. В нервных клетках высших организмов находят D-Ala, D-Asp и D-Ser, иногда в значительных концентрациях. Поэтому в деталях биологический мир не обнаруживает хиральной чистоты, но все, что относится к рибосомальному синтезу полипептидов, характеризуется абсолютной хиральной чистотой.

Нарушение хиральной чистоты аминокислот в белках является следствием их посттрансляционной модификации – неферментативной рацемизации и изомеризации аминокислот в белках. Причем из двадцати аминокислот, участвующих в рибосомальном синтезе, прежде всего Asp- и Asn-остатки в белках являются наиболее подверженными неферментативной модификации: рацемизации и изомеризации. Если накопление остатков D-Asp в белках – достаточно долгий процесс, который является наиболее значимым для очень медленно обновляющихся белков и белков организма, вовлеченных в патофизиологические процессы при заболеваниях пожилого возраста, то появление остатков iAsp в белках – существенно для функционирования медленно обновляющихся белков даже в норме.

Посттрансляционные неферментативные модификации аминокислот в белках играют существенную роль в патогенезе болезней, характерных для людей пожилого возраста. Так установлено появление значительного содержания остатков D-Asp в белках организмов с болезнью Альцгеймера, Паркинсона, а также при склеротических изменениях в сердечно-сосудистой системе, при глазной катаракте и т.д. Некоторые исследователи рассматривают содержание остатков D-Asp в белках как патофизиологический фактор в патогенезе болезней пожилого возраста, таких как атеросклероз, эмфизема легкого, катаракта, дегенеративные заболевания хряща и возрастная дисфункция головного мозга и др.

Исследование влияния посттрансляционных модификаций аминокислотных остатков белков на их структуру и механизмы функционирования остаётся малоисследованным направлением в биофизике. Прежде всего, это относится к биологически активным соединениям стереоспецифичного действия, которые могут оказывать как более, так и менее активное действие на белки организмов, подверженным возрастным изменениям.

Отдавая должное значительным успехам экспериментальной молекулярной геронтологии последних лет, достигнутым в данном направлении, следует отметить, что в ряде случаев функциональные нарушения, связанные с хиральными нарушениями, можно исследовать исключительно в модельных компьютерных экспериментах. В первую очередь это относится к молекулярным структурам, присутствующим в отдельных клетках в незначительных количествах, как, например, в белковых ион-транспортных системах мембран. Тем более, когда изменение знака хиральности захватывает аминокислотные группы, укрытые в их гидрофильных ион-связывающих полостях. При этом принципиально важно в рамках единого численного эксперимента выполнить сравнение функций нормальных и хирально модифицированных молекулярных структур.

Таким образом, представляется перспективным исследование структуры и механизмов функционирования ионных каналов по следующим направлениям:

1) Выбор и обоснование метода расчета энергетических профилей ионов в каналах, не требующего значительных затрат расчетного времени и выявляющего с хорошей точностью функциональные характеристики природных и модифицированных ионных каналов.

2) Исследование функциональных характеристик природных ионных каналов, для которых известны их электрохимические характеристики.

3) Построение хирально модифицированных1 модельных ионных каналов, исследование их структуры и функциональных характеристик.

4) Исследование влияния неферментативной модификации остатков Asn и Asp в ионных каналах на их структуру и функциональные характеристики.

Цель и задачи исследования. Целью настоящего исследования являлось теоретическое исследование структурных и функциональных характеристик природных и хирально модифицированных модельных ионных каналов с инвариантной и измененной аминокислотной последовательностью.

Для достижения цели исследования решались следующие задачи:

1) Выбор и обоснование метода расчета энергетических профилей ионов в мембранных каналах, не требующего значительных затрат расчетного времени и Под хирально модифицированными ионными каналами мы понимаем каналы, в которых проведена замена их L-аминокислот на соответствующие D-аминокислоты.

предсказывающего с хорошей точностью функциональные характеристики каналов.

2) Построение хирально модифицированных модельных каналов с первичной структурой, инвариантной природным каналам, исследование их структурных и функциональных характеристик.

3) Разработка метода построения структуры хирально модифицированных модельных каналов с модифицированной первичной структурой и функциональными характеристиками, адекватными характеристикам природных каналов.

4) Построение математической модели изменения содержания остатков iAsp и D-Asp в белках, а также оценка степени аккумуляции остатков iAsp в белках, время обновления которых больше времени образования остатков iAsp.

5) Исследование влияния посттрансляционных неферментативных модификаций остатков Asn и Asp в ионных каналах на их структурные и функциональные характеристики.

Объект и предмет исследования. Объектом теоретического исследования являлись:

1) ионные каналы клетки (потенциал-независимый калиевый канал KcsA из Streptomyces lividans, потенциал-зависимый калиевый канал KvAP из Aeropyrum pernix, потенциал-зависимый калиевый канал Kv1.2 из Rattus norvegicus, комплекс - и -субъединицы калиевого канала из Homo sapiens);

2) NR1-центр связывания NMDA-рецептора из Rattus norvegicus в комплексе с Gly, D-Ser и D-cSer;

3) модельные D-аминокислотные каналы с модифицированной и инвариантной природной первичной структурой;

4) модельные ионные каналы, содержащие остатки D-Asp и iAsp.

Сведения о четвертичной структуре природных белков получены из Банка белковых структур2. Выбор выше указанной группы каналов обусловлен тем, что для них существуют надежные экспериментальные данные по структуре и функциональным характеристикам.

Предметом исследования являлись механизмы функционирования природных и хирально модифицированных модельных ионных каналов.

Protein Data Bank, Brookhaven National Laboratory, USA Предпосылки и направление исследования. Экспериментально обнаруженная и теоретически изучаемая модификация отдельных аминокислотных остатков каналов приведет не к ожидаемой инвариантности их третичной структуры, а к ее нарушению. Последнее обстоятельство является причиной изменения функциональных характеристик каналов. Для построения хирально модифицированных модельных каналов с природной функциональностью необходима модификация их первичной структуры. Появление остатков D-Asp и iAsp в ионных каналах, обусловленное старением организма или его патологическим состоянием, повлечет изменение их функциональных характеристик и в определенных случаях нарушение механизмов их функционирования.

Научная новизна и значимость полученных результатов. В результате исследований впервые:

1) Теоретически обоснован и применен для расчета энергетических профилей ионов в каналах комбинированный квантово-классический метод. Установлено расстояние, характеризующее разделение аминокислотных остатков ионных каналов на ближние и дальние.

2) Установлено, что использование полученных комбинированных энергетических профилей дает возможность вычислять функциональные характеристики каналов с хорошей точностью, что показано на примере ионной специфичности калиевых каналов клетки. Предложена и теоретически обоснована модельная структура ионного канала в виде комплекса и субъединиц, согласующаяся с экспериментально наблюдаемой структурой гомологичного потенциал-зависимого калиевого канала Kv 1.2.

3) Построены хирально модифицированные модельные каналы с инвариантной природной аминокислотной последовательностью, которые являются энергетически менее стабильными, чем их природные антиподы с нарушенными функциональными характеристиками.

4) Предложен метод, основанный на вариации первичной структуры и энергетическом выравнивании третичных структур, позволяющий моделировать атомную структуру хирально модифицированного модельного канала с природной функциональностью. Построенные из 10 D-аминокислотных остатков каналы являются энергетически эквивалентными по полной механической энергии соответствующим природным каналам и с аналогичными функциональными характеристиками.

5) Построена математическая модель, описывающая изменение содержания остатков iAsp и D-Asp в белках, с помощью которой показано, что аккумуляция остатков iAsp – значимый процесс не только для очень медленно обновляющихся, но и для медленно обновляющихся белков, таких как ионные каналы.

6) В численном эксперименте показано, что появление остатков iAsp в калиевых ионных каналах приводит к уменьшению их энергетической стабильности, незначительному увеличению ионных токов при сохранении их калиевой избирательности. Появление остатков D-Asp в NR1-центре связывания NMDAрецептора, обусловленное патофизиологическими процессами при хронических заболеваниях пожилого возраста, приводит к появлению дополнительных алифатических аминокислотных лигандов (D-Ala, D-Leu, D-Ile и D-Pro), что не свойственно для немодифицированного NR1-центра связывания.

Методология и методы проведенного научного исследования. В работе использовались как традиционные методы расчета энергетических профилей ионов (силовые поля молекулярной механики) и функциональных характеристик каналов (теория абсолютных скоростей реакций Эйринга), так и:

1) адаптированный и теоретически обоснованный нами для расчета энергетических профилей ионов в поре канала комбинированный квантовоклассический метод;

2) разработанный нами метод «энергетического выравнивания» третичных структур белков как метод построения хирально модифицированных модельных каналов с измененной первичной структурой, структурно и функционально эквивалентных соответствующим природным каналам.

Практическая значимость полученных результатов. Разработанные подходы позволяют изучать функциональные характеристики ионных каналов, моделировать атомные структуры хирально модифицированных модельных ионных каналов с функциональными характеристиками, свойственными природным каналам.

Теоретически установленные изменения в работе каналов, обусловленные in vivo появлением в них остатков D-Asp и iAsp в результате старения организма или при патологических состояниях, позволяют наметить пути поиска эффективных лекарственных препаратов, в качестве активных центров которых служат рецепторы ионных каналов.

Учитывая, что значительное число заболеваний связано с «каналопатологиями» - нарушениями функционирования ионных каналов или связанных с ними рецепторов, полученные результаты и разработанные подходы могут быть использованы при разработке стратегии и средств лечения этих заболеваний.

Полученные результаты могут применяться при исследовании биологического отклика организмов на хиральные фармпрепараты и модификацию аминокислотных остатков каналов под воздействием антропогенных внешних факторов при решении проблем хиральной безопасности биосферы.

Полученные результаты расширяют представления о физических механизмах происхождения хиральной асимметрии биосферы, функционирования ионных каналов и могут быть использованы в курсах лекций по биофизике, биохимии и физиологии в университетах и вузах медико-биологического профиля.

Основные положения диссертации, выносимые на защиту.

1) Теоретическое обоснование комбинированного квантово-классического метода для расчета энергетических профилей, с помощью которого установлено, что в клетке с хирально модифицированными калиевыми каналами с природной первичной структурой будут нарушены многие биологические процессы, обусловленные функционированием калиевых ионных каналов. Появление остатков iAsp в калий-избирательных каналах и остатков D-Asp в NR1-центре связывания NMDA-рецептора, обусловленное посттрансляционными неферментативными модификациями аминокислотных остатков, приводит к нарушению структуры и функциональных характеристик каналов.

2) Разработанный и теоретически обоснованный нами метод энергетического выравнивания структур каналов, с помощью которого были построены Dаминокислотные модельные каналы с природными функциональными характеристиками и модифицированной аминокислотной последовательностью из 10 Dаминокислот: Gly, Ala, Ser, Cys, Asp, Asn, Lys, His, Phe, Pro.

Личный вклад соискателя. Выбор и обоснование научной тематики исследования, получение результатов, приведенных в диссертации, их анализ и интерпретация, как и основные публикации, сделаны при решающем участии соискателя.

Апробация работы. Результаты исследований по теме диссертации представлены на 3-й Региональной научно-технической конференции «Проблемы экологии и экологической безопасности ЦЧ РФ» (Липецк, 1999), 7-й Международной конференции «Математика. Компьютер. Образование» (Дубна, 2000), 3-м Всероссийском медицинском конгрессе (Ижевск, 2000), 3-м Сибирском конгрессе по прикладной и индустриальной математике (Новосибирск, 1998), 5-й Международной конференции «Физика в системе современного образования» (Санкт-Петербург, 1999), 3-й Всероссийский симпозиум «Математическое моделирование и компьютерные технологии» (Кисловодск, 1999), 4-м Сибирском конгрессе по прикладной и индустриальной математике (Новосибирск, 2000), 5й Республиканской электронной научной конференции «Современные проблемы информатизации» (Воронеж, 2000), Международной конференции «Математика.

Образование. Экология. Гендерные проблемы» (Воронеж, 2000), 4-й Международной научно-технической конференции «Физика и радиоэлектроника в медицине и экологии» (Владимир, 2000), Международной конференции «Биохимическая физика на рубеже столетий» (Москва, 2000), 2-й Региональной научной конференции по органической химии «Органическая химия на пороге третьего тысячелетия – итоги и перспективы» (Липецк, 2000), 5-й Пущинской конференции молодых ученых «Биология – наука 21-го века» (Пущино, 2001), 8-й Международной конференции "Математика. Компьютер. Образование» (Пущино, 2001), 2-й Конференции молодых ученых России с международным участием «Фундаментальные науки и прогресс клинической медицины» (Москва, 2001), 3й Всероссийской научной конференции «Молекулярная физика неравновесных систем» (Иваново, 2001), Международном симпозиуме «Компьютерное обеспечение химических исследований» (Москва, 2001), 7th Scandinavian Symposium on Chemometrics (Copenhagen, 2001), XVIII Съезде физиологического общества им.

И.П. Павлова (Казань, 2001), Школе-семинаре «Введение в многомерный анализ данных (проекционные методы)» (Москва, 2001), 3-й Всероссийской школеконференции по квантовой и вычислительной химии им. В.А. Фока (Великий Новгород, 2001), Международной школе-конференции «Введение в многомерный анализ данных (проекционные методы)» (Кострома, 2002), 13th International Congress on Molecular Biology (Toronto, 2002), 8-м Всероссийском симпозиуме «Биоинформатика и компьютерное конструирование лекарств» (Москва, 2002), 6-й Пущинской школе-конференции молодых ученых «Биология – наука 21-го века» (Пущино, 2002), 3-й Всероссийской конференции «Молекулярное моделирование» (Москва, 2003), 4th Symposium on Multivariate Data Analysis (Moscow, 2003), 3-м Съезде биофизиков России (Воронеж, 2004), 4-й Всероссийской конференции «Молекулярное моделирование» (Москва, 2005), Международной конференции студентов, аспирантов и молодых ученых «Ломоносов-2005» (Москва, 2005), Международной научной конференции «Молекулярные, мембранные и клеточные основы функционирования биосистем» (Минск, 2006), 5-м Съезде Белорусского общественного объединения фотобиологов и биофизиков (Минск, 2006), Всероссийской научной конференции «Актуальные проблемы естественных наук и их преподавания» (Липецк, 2006), 5-й Всероссийской конференции «Молекулярное моделирование» (Москва, 2007), 3-м Всероссийском съезде фармакологов (Санкт-Петербург, 2007), 5-м Международном семинаре «Компьютерное моделирование электромагнитных процессов в физических, химических и технических системах» (Воронеж, 2007), 5-м Международном семинаре «Физико-математическое моделирование систем» (Воронеж, 2008).

Опубликованность результатов. По материалам диссертации опубликовано 49 печатных работ: 20 статей в рецензируемых научных журналах по списку ВАК, статьи в других журналах, изданиях и тематических сборниках – 9, в материалах конференций – 20. Список основных работ по теме диссертации приведен в конце автореферата.

Структура и объем диссертации. Диссертация включает введение, основную часть, состоящую из 4 глав, заключение, основные выводы и список цитируемой литературы. Диссертация изложена на 315 страницах, содержит рисунков и 39 таблиц.

ОСНОВНОЕ СОДЕРЖАНИЕ РАБОТЫ

В первой главе рассмотрены возможности и ограничения распространенных методов расчета и анализа энергетических профилей ионов в мембранных каналах. Исследованы прогностические возможности метода молекулярной механики для их расчета. Теоретически обоснован и апробирован для расчета энергетических профилей ионов в поре канала комбинированный квантовоклассический метод.





Движение иона в трансмембранном канале однозначно характеризуется функцией его потенциальной энергии, которая в явном или неявном виде включена во все уравнения, описывающие ионный транспорт в канале (молекулярной и ланжевеновой динамики, Пуассона-Нернста-Планка). Для оценки функциональных характеристик канала кинетическая теория переходного состояния Эйринга использует профиль свободной энергии Гиббса, одной из составляющих которого является потенциальная энергия иона.

При однорядном прохождении ионов через пору канала потенциальная энергия иона зависит от координаты оси канала (оси аксиальной симметрии) E = E(Z). Традиционно для расчета E = E(Z) применяются либо методы молекулярной механики, либо квантовой химии. Методы молекулярной механики в данных расчетах не требуют значительных затрат расчетного времени, но их точность не всегда является удовлетворительной. Большинство расчетных методов квантовой химии лишены последнего недостатка, но требуют значительных затрат расчетного времени.

Вопрос о точности оценки энергетического профиля иона в поре канала является наиболее сложным в исследованиях ионного транспорта, что, прежде всего, обусловлено невозможностью прямого сопоставления расчетного профиля с экспериментальным. В этом случае по полученным энергетическим профилям осуществляется оценка функциональных характеристик канала, которые возможно сопоставить с экспериментальными значениями. К таким характеристикам в первую очередь относятся вольтамперные характеристики, ионные проводимости, отношения коэффициентов проницаемости для различных ионов.

Многообразие расчетных методов приводит к тому, что в работах, посвященных теоретическому исследованию ионного транспорта в каналах, часто встречается совпадение функциональных характеристик каналов, оцененных по (качественно и количественно) различным профилям иона одного и того же канала. Это совпадение, как правило, является следствием физически не обоснованной калибровки энергетических профилей и параметров уравнений для расчета функциональных характеристик каналов.

Предварительно для расчета энергетических профилей мы использовали наиболее распространенные силовые поля молекулярной механики (AMBER, CHARMM, OPLS) и проводили их количественный анализ, применяя теорию переходного состояния для последующего сопоставления расчетных и экспериментальных результатов.

Свободная энергия Гиббса системы ион-вода-канал Giwc(Z)= Eic(Z)+ Eww(Z)+ Ewc(Z)+ Eiw(Z)- TSiwc(Z), (1) где, в квазистатическом приближении, Eic(Z)= Eic(Z,) – потенциальная энергия комплекса ион-канал, – эффективная диэлектрическая постоянная, зависящая от диаметра поры канала d, Eww(Z), Ewc(Z) и Eiw(Z) – потенциальная энергия комплекса вода-вода, вода-канал и ион-вода, соответственно, Siwc(Z) – энтропия.

Зависимость = (d) рассчитывали численным решением уравнения Буза (Conway, 1981), величину Eiw (Z)- TSiwc(Z) – по полуэмпирическим формулам Лайо-Торрэ (Laio & Torre, 1999), включающих экспериментальные значения свободной энергии Гиббса комплексов, содержащих i молекул воды и катион в газовой фазе.

Величину Eww(Z)+ Ewc(Z) с хорошей степенью точности можно считать постоянной, не зависящей от локализации иона, для определенного канала. По результатам численного моделирования методом Монте-Карло установлено, что в зависимости от положения иона на оси канала Eww(Z)+ Ewc(Z) принимает постоянное значение для определенного канала, при этом ошибка составляет не более 2%. Данный результат может быть обоснован статистической природой рассматриваемых взаимодействий и свойствами потенциалов межмолекулярного взаимодействия.

В методах силового поля Eic представляется в виде суммы энергии кулоновского и вандерваальсового взаимодействия атомов канала и иона:

n n q A B i i i E = + (2) R - , ic 12 i=1 R i=1 R i i i где q – кулоновский заряд i-го атома канала, R – расстояние от i-го атома каi i нала до иона, Ai, Bi – параметры вандерваальсового взаимодействия i-го атома и иона. Практически все традиционные силовые поля, применяемые в исследовании биомолекул, используют представление (2). Отличие наблюдается лишь в выражениях для параметров A и B. Силовые поля AMBER и CHARMM исi i пользуют r -параметризацию:

12 r r r r i ion i ion A = + , B = 2 + , (3) i i ion i i ion 2 2 2 где r, r, , – параметры силового поля. Силовое поле OPLS традиционно i ion i ion использует -параметризацию:

6 A = 4( ) , B = 4( ) , (4) i i ion i ion i i ion i ion где i, ion, , – параметры силового поля. В случае потенциальной энерi ion гии взаимодействия двух одинаковых атомов или ионов параметр r соответствует их вандерваальсову радиусу, – их равновесной энергии.

Важно отметить, что в подобных расчетах величины r, , являются калибровочными параметрами, прежде всего по соображениям «равновесной геометрии» биомолекулярных систем. Поэтому нами исследована возможность замены параметра r кристаллографическими и реальными ионными радиусами для возможного улучшения результатов.

В качестве тестируемого мембранного канала нами выбран потенРис. 1. Поперечный срез канала KcsA циал-активируемый бактериальный калиевый канал KcsA из Streptomyces lividans. Данный выбор не является случайным, т.к. для данного канала существуют наиболее достоверные экспериментальные значения его функциональных характеристик. Канал KcsA является тетрамером. На рис. 1 представлен поперечный срез канала, демонстрирующий две из четырех его субъединиц. Пору канала можно условно разделить на три области: селективный фильтр, ответственный за ионную избирательность канала (I), относительно большую центральную полость (II) и нижнюю внутреннюю пору (III).

Профили G = G (Z) ионов Cs+, Rb+, K+, Na+ и Li+, с рассчитанными iwc iwc методом силового поля AMBER E (Z)= E (Z,), представлены на рис. 2.

ic ic Приведенные профили различаются во всех областях поры канала. Причем наиболее существенное различие энергетических профилей катионов наблюдается в области нижней поры канала. В нижней поре и в селективном фильтре канала KcsA существуют энергетические барьеры, причем их высоты для различных ионов находятся в следующей последовательности Cs+>Rb+>K+>Na+>Li+. В таком случае канал KcsA имеет расчетный ряд селективности Cs+Na+>Li+)! Аналогичные результаты были получены для профилей свободной энергии катионов, рассчитанных методом силового поля OPLS.

Таким образом, профили, рассчитанные методом силового Рис. 2. Профили свободной энергии ионов в поре канала поля, во-первых, не KcsA объясняют энергетическую предпочтительность дегидратации K+ по сравнению с другими ионами, а, во-вторых, не объясняют прохождение K+ через не реально высокий для прохождения ионов энергетический барьер (28 ккал/моль) нижней поры канала.

Для получения количественных оценок функциональных характеристик канала использовали уравнения теории абсолютных скоростей реакций Эйринга.

В таком случае профиль свободной энергии Гиббса канала может быть представлен в виде последовательности M энергетических барьеров, разделенных M1 потенциальными ямами.

Вольтамперную характеристику (ВАХ) канала J = J () определяли по I I формуле + J = k p - k p. (5) I M M-1 1 Находя производную функции JI = JI() по переменной , определяли проводимость одиночного канала g. Для объяснения ионной селективности I мембранного канала мы использовали теорию Эйринга, которую количественно P B можно охарактеризовать как отношение проницаемостей для сравниваемых P A ионов А и В по формуле M M i- PB [GAi exp + - exp RT] l - l h h i=1 PA h=i+1 h=1 PB MA =, (6) M i-PA M MB PB + [GBi exp lh exp RT] l h i=1 PA h=i+1 h=1 + где М – масса иона. В зависимостях (5) и (6): ki ( ki ) – константа скорости перехода из ямы i-1 в яму i (из ямы i в яму i-1), pi (i 0) – вероятность того, что ион находится в i-й яме, p0 – вероятность того, что канал не заполнен ионами. Константы скорости перехода определяли по формулам + (w + ki = exp[-(Gi - Gi-1)) RT - zFli RT], - (w ki = exp[-(Gi - Gi )) RT + zFli RT], (w + где Gi (Gi )) – значение энергии иона в i-м барьере (i-й яме), li (li ) – электрическое расстояние между i-1 ямой и i-м барьером (между i-й ямой и i-м барьером), = 6.11012 c-1– частотный фактор.

Рассчитанные по формуле (5) ВАХ канала в условиях симметричных монокатионных растворов ([I] = [I] = 0.4 М) представлены на рис. 3.

L R Расчет методом AMBER показывает существование линейной зависимости между током и напряжением на участке 0-60 мВ с величиной проводимости одиночного канала для K+ 0.016 пСм, Рис. 3. Вольтамперные характеристики канала KcsA (профидля Na+ 1.3 пСм, ли свободной энергии рассчитывали методом AMBER) для Li+ 0.68 пСм, для Rb+ 0.003 пСм, для Cs+ 0.001 пСм. Данные значения проводимостей находятся в разногласии с экспериментальными данными, согласно которым значение проводимости для различных типов калиевых каналов для K+ меняется от 4 до 270 пСм. Расчетные по формуле (6) значения отношений коэффициентов проницаемости для Li+, Na+, K+, Rb+ и Cs+ к коэффициенту проницаемости для K+ составляют 41.2, 83.1, 1, 0.2 и 0.07, соответственно. Данные значения не только противоречат экспериментальным данным (<0.09, <0.07, 1.00, 0.25-0.91 и <0.18), но и предсказывают существование селективного ряда, несвойственного калиевым каналам.

Таким образом, профили свободной энергии Гиббса, полученные методом силового поля, не только не позволяют дать количественное объяснение ионной избирательности канала, но и получить правильные качественные оценки его функциональных характеристик.

Данный вывод делает настоятельно необходимым использовать метод расчета профиля свободной энергии Гиббса, не требующий значительных затрат машинного времени и сохраняющий точность квантовохимического расчета.

Этот метод может быть предложен, если учесть, что специфические квантовомеханические эффекты, возникающие при расчете взаимодействия в системе ионканал, существенны лишь на небольших расстояниях, т.е. там, где значимо перекрывание электронных оболочек иона и атомов молекул канала.

В таком случае, возможно, использовать идеологию комбинированного квантово-классического метода (Day et al., 1996) для расчета потенциальной q c энергии системы ион-канал, которую можно представить в виде Eic = Eic + Eic, q где Eic – квантовомеханическая составляющая результирующей энергии, сущеc ственная при малых расстояниях ион – атомы канала, Eic – классическая (кулоновская) составляющая, существенная при больших расстояниях ион – атомы канала.

q Энергию Eic целесообразно рассчитывать одним из квантовохимических c методов для системы ион – ближние к нему аминокислоты, энергию Eic рассчитывать в приближении точечных зарядов на атомах qi дальних аминокислот по N c традиционной кулоновской схеме Eic = ri. Причем в качестве зарядов на q i i=атомах qi можно использовать параметры электростатических взаимодействий одного из силовых полей или точечные заряды на атомах, рассчитанные квантовохимически.

Наиболее простым в формальном отношении и одновременно дающим разумные результаты в некоторых случаях является метод Хоффмана или расширенный метод Хюккеля (EHT). Формально уравнения EHT представляются в виде:

с (Fµ - Sµ ) = 0, F - S = 0.

iµ µ µ Матричные элементы F заменяются эмпирическими параметрами или аппрокµ симируются специально подобранными соотношениями, включающими эти параметры. Так, диагональные матричные элементы F полагаются равными поµµ тенциалам ионизации соответствующих валентных электронов, взятых с обратным знаком F = -I. Для вычисления недиагональных матричных элементов µµ µ F мы использовали параметризацию Вольфсберга-Гельмгольца µ F = 0.5K(F + F )S, где К= 1.75.

µ µµ µ Метод EHT дает адекватные результаты для молекулярных систем, имеющих равномерное распределение заряда по всем атомам или, иначе говоря, для молекул, атомы которых не сильно отличаются по электроотрицательности (обычно принимают различие не более 1.4 по шкале Полинга). Канал KcsA, как и многие другие каналы, формируется атомами C, O, N, S и H, электроотрицательности которых составляют 2.5, 3.6, 3.0, 2.5 и 2.1 соответственно, для катионов Li+, Na+, K+, Rb+ и Cs+ – 1.5, 3.3, 2.6, 2.4 и 1.8, соответственно (Бацанов, 2000). Таким образом, максимальное значение для атомов канала KcsA составляет 1.5, причем только для не связанных ковалентными связями для Li+ и карбонильных кислородов, формирующих пору канала. Следовательно, применение метода EHT для решения поставленных задач представляется вполне обоснованным.

q c Центральным вопросом расчетов по схеме Eic = Eic + Eic является вопрос о расстоянии между ионом и атомами поры канала, на котором возможно данное разделение. Применительно к расчету энергии взаимодействия иона и молекулы канала, целесообразно провести такой расчет в приближении точечных зарядов на атомах отдельных аминокислот, а также квантовохимически в системе ион – соответствующая аминокислота. Вид и характер рассчитанных функций потенциальной энергии E = E(r), где r – расстояние между ионом и аминокислотой, позволит определить координату точки их расхождения. Для определения координат точки разделения двух функций нами проведены квантовохимические и классические расчеты зависимости энергии взаимодействия от взаимного расстояния в системе ион–аминокислота. Подобные расчеты проведены для всех аминокислот и 5 исследуемых ионов. Наши расчеты показывают, что в зависимости от выбора аминокислоты, координаты точки расхождения E = E(r) составляют 3.2–4.2.

Таким образом, расстояние разделения взаимодействий должно быть не меньше 4.2. Для упрощения расчетов нами принято R=5.

c Для расчета Eic применяли параметры электростатических Рис. 4. Профили свободной энергии KcsA (расчет методом взаимодействий (заEHT/AMBER) ряды на атомах) силового поля AMBER.

Данный выбор обусловлен тем, что результаты расчета методом AMBER хорошо сочетаются и согласуются с результатами квантовохимического расчета распределения потенциала в канале.

Рис. 5. Вольтамперные характеристики канала KcsA Профили свобод- (энергетические профили рассчитывали методом EHT/AMBER) ной энергии Гиббса канала KcsA, рассчитанные методом EHT/AMBER, представлены на рис. 4.

Данные профили имеют качественно сходный вид для всех исследуемых ионов и соответствуют пятибарьерной модели канала. При этом наблюдается только количественное расхождение профилей. Величины энергетических барьеров ионов по абсолютной величине находятся в последовательности Li+>Na+>K+~>Rb+>Cs+. Учитывая, что последовательность энергетических барьеров ионов определяет последовательность ионных токов и рядов селективности, можно обоснованно прогнозировать согласие расчетных функциональных характеристик канала с экспериментальными.

Для проверки данного предположения нами проведен расчет функциональных характеристик канала по формулам (5) и (6), используя профиль, рассчитанный методом EHT/AMBER. Результаты расчета ВАХ канала в условиях симметричных монокатионных растворов ([I] = [I] = 0.4 М) представлены на L R рис. 5.

Полученный результат показывает существование линейной зависимости между током и напряжением на участке 0-60 мВ, с величиной проводимости одиночного канала для K+ 26.34 пСм, для Na+ 1.72 пСм, для Li+ 0.24 пСм, для Rb+ 19.42 пСм, для Cs+ 0.03 пСм, что соответствует экспериментально получаемым значениям. Расчетные по формуле (7) значения отношений коэффициентов проницаемости для Li+, Na+, K+, Rb+ и Cs+ к коэффициенту проницаемости для K+ составляют 0.009, 0.065, 1.000, 0.737 и 0.001, соответственно, что хорошо согласуется с экспериментальными данными (<0.09, <0.07, 1.00, 0.25-0.91 и <0.18).

В основу метода EHT, как и подавляющего большинства полуэмпирических методов, положено валентное приближение, т.е. явный учет только валентных электронов. Невалентные электроны совместно с ядром формирует эффективный точечный электростатический заряд. В случае исследуемой нами молекулярной системы ион – канал, валентное приближение, на первый взгляд, является не применимым для расчета электронной структуры ионов Li+, Na+, K+, Rb+, Cs+.

Выход из отмеченного затруднения заложен в используемой нами расчетной схеме метода EHT. Ион рассматриваются как соответствующий атом в валентном приближении, но при этом его ядру формально присваивается положительный точечный заряд +2, а не +1.

Не вызывает сомнений, что такой подход негативно отразится на оценке вандерваальсовых радиусов ионов и атомов, локализованных в области поры канала, и, возможно, на оценке энергетического профиля иона в канале.

Для проверки отсутствия данной ошибки нами проведен расчет энергетических профилей ионов в поре потенциал-независимого калиевого канала KcsA неэмпирическим квантовохимическим методом самосогласованного поля в биэкспоненциальном базисе DZVP (Godbout, 1992), с последующим сравнением полученных результатов с результатами EHT-расчетов.

В результате было установлено, что функциональные характеристики канала KcsA, полученные анализом DZVP- и EHT-энергетических профилей ионов хорошо согласуются друг с другом и с экспериментально наблюдаемыми значениями (абсолютная ошибка составляет не более 4%).

Во второй главе приведены результаты исследования функциональных характеристик потенциал-зависимых калиевых каналов клетки по результатам анализа профилей свободной энергии, рассчитанных методом EHT/AMBER, решением уравнений теории абсолютных скоростей реакций Эйринга.

К потенциал-зависимым калиевым каналам клетки относятся каналы, спеРис. 6. Структура открытого канала KvAP.

(А) Вид сверху.

(В) Вид сбоку на одну из субъединиц.

цифически активируемые деполяризацией клеточной мембраны и ассоциированные с мембранной реполяризацией. Калиевые каналы играют важную роль в процессах возбудимости и проводимости мембран. Практически все каналы суперсемейства потенциал-зависимых калиевых каналов являются аксиальносимметричными белковыми порами, что дает возможность использовать разработанный и апробированный на канале KcsA алгоритм расчета функциональных характеристик каналов.

Потенциал-зависимый калиевый канал KvAP содержит стандартную K+пору, окруженную сенсорами напряжения. Сенсоры напряжения могут менять конфигурацию за счет изменения разности потенциалов на концах мембраны и открывать пору. Они локализованы около внутриклеточной поверхности канала.

Исследовательской группой Р. Маккинона (2003) определена атомная структура калиевого канала и было высказано предположение о том, что KvAP в зависимости от направления мембранного потенциала, Рис. 7. Профили свободной энергии открытого канала определяющего поKvAP ложение сенсора в пространстве, может находиться в двух конформациях: открытой – пропускающей ионы, и закрытой – не пропускающей ионы. При изменении разности потенциалов на концах мембраны Рис. 8. Профили свободной энергии закрытого канала KvAP подвижный сенсор напряжения занимает новое положение, что приводит к переходу канала из открытого состояния в закрытое, и наоборот. Модель Р. Маккинона объясняет переход канала из одного состояния в другое, но не дает ответа на вопрос о механизмах калиевой избирательности открытого и отсутствия таковой для закрытого канала KvAP.

Нами проведено теоретическое исследование функциональных характеристик открытого и закрытого канала KvAP. Результаты расчета профилей свободной энергии для ионов Li+, Na+, K+, Rb+, Cs+ в поре открытого и закрытого канала представлены на рис. 7 и 8, соответственно. Профили Giwc = Giwc(Z) в области селективного фильтра и центральной полости открытого и закрытого аналогичны профилям энергии в соответствующих областях потенциал-независимого калиевого канала KcsA, что является следствием гомологичности каналов KvAP и KcsA. Существенное отличие Giwc = Giwc(Z) каналов KvAP и KcsA наблюдается только в области нижней поры, что обусловлено наличием дополнительных сенсоров напряжения в канале KvAP. В данной области открытого и закрытого канала KvAP появляются энергетические барьеры для всех видов ионов. Причем в закрытом канале значения энергетических барьеров больше, чем в открытом и в закрытом канале KvAP, а величина диаметра закрытого канала в области нижней поры меньше, чем открытого. Это различие приводит к увеличению стерических ограничений для ион-водного комплекса и, как следствие, к увеличению значения энергии данного комплекса в закрытом канале.

Таким образом, появление Рис. 9. ВАХ открытого канала KvAP больших, по сравнению с открытым каналом, энергетических барьеров в области нижней поры закрытого канала KvAP может быть причиной наблюдаемого отсутствия ионной проводимости канала.

Рис. 10. ВАХ закрытого канала KvAP Для количественного обоснования данного утверждения нами проведен анализ полученных профилей решением уравнений (5) и (6). Результаты расчета ВАХ для открытого и закрытого одиночного канала KvAP в условиях симметричных монокатионных растворов ([I] = [I] = 0.04 М) представлены на рис. 9 и 10, соответственно.

L R Данные связи показывают существование линейной зависимости между током и напряжением на участке 0–60 мВ с величиной проводимости одиночного открытого канала для K+ 12.93 пСм, для Na+ 0.32 пСм, для Li+ 0.13 пСм, для Rb+ 9.пСм, для Cs+ 0.083 пСм, что соответствует экспериментально получаемым значениям. Проводимости закрытого канала для K+, Na+, Li+, Rb+ и Cs+ принимают значения 0.10 пСм, 0.007 пСм, 0.002 пСм, 0.066 пСм и 0.001 пСм, соответственно.

Таким образом, появление значительного энергетического барьера в канале KvAP при переходе его из открытого состояния в закрытое при изменении разности потенциалов на концах мембраны является причиной появления малых ионных токов, характерных для закрытого ионного канала.

Расчетные значения отношений коэффициентов проницае- Рис. 11. Модельная структура /-канала мости для Li+, Na+, K+, Rb+ и Cs+ к коэффициенту проницаемости для K+ составляют 0.010, 0.024, 1.000, 0.701 и 0.006, соответственно, что хорошо согласуется с экспериментальными данными.

Потенциал-зависимые калиевые каналы обычно экспрессируются вместе с дополнительными -субъединицами. В работах группы Р. Маккинона была определена с разрешением 2.8 структура -субъединицы калиевого канала. При этом структура -субъединицы канала определена не была.

При построении структуры потенциал-зависимого калиевого канала в виде комплекса - и -субъединиц (/-канал) мы исходили из совпадения осей аксиальной симметрии - и -субъединицы. При этом -субъединица стыкуется с вогнутой поверхностью -субъединицы (Рис. 11). В качестве -субъединицы мы использовали аксиально-симметричный тетрамер потенциалнезависимого калиевого канала KcsA, как каноническую пороформирующую субъединицу трансмембранных калиевых каналов клетки.

Результаты Рис. 12А. Профили свободной энергии в области селекрасчета профилей оттивного фильтра и центральной полости -субъединицы открытого /-канала крытого канала для ионов Li+, Na+, K+, Rb+, Cs+ представлены на рис. 12. Для наглядности профили свободной энергии потенциал-зависимого калиевого /-канала представлены для трех последовательных интервалов измеРис. 12Б. Профили свободной энергии в области нижней поры -субъединицы и поры -субъединицы открытого нения координаты оси /-канала Z: области селективного фильтра и центральной полости -субъединицы (рис. 12А), области нижней поры -субъединицы и поры -субъединицы (рис. 12Б).

Анализ энергетического профиля показывает, что основными факторами, влияющими на характер транспорта иона через канал, являются: частичная дегидратация иона при входе в пору канала и взаимодействие иона с атомными группами канала. Повышение энергии иона в результате дегидратации оказывается наибольшим у иона Li+ и наименьшим у иона K+, что обусловлено наибольшими размерами последнего, а значит, меньшими (по модулю) величинами его взаимодействия с молекулами воды в первой гидратной оболочке.

Результаты расчета ВАХ для /-канала в условиях симметричных монокатионных растворов ([I] = [I] = 0.04М) представлены на рис. 13. Данная связь L R показывает существование линейной зависимости между током и напряжением на участке 0-60 мВ с величиной проводимости одиночного канала для K+ 17.пСм, для Na+ 0.пСм, для Li+ 0.26 пСм, для Rb+ 16.63 пСм, для Cs+ 0.08 пСм, что соответствует экспериментально получаемым значениям.

Рис. 13. ВАХ открытого /-канала Проводимость /канала для ионов калия несколько меньше, чем проводимость канала KcsA для соответствующих ионов, что является следствием наличия дополнительной -субъединицы в /канале. Для ионов лития и натрия наблюдается незначительное расхождение в значениях проводимости каналов / и KcsA. Расчетные значения отношений коэффициентов проницаемости для Li+, Na+, K+, Rb+ и Cs+ к коэффициенту проницаемости для K+ составляют 0.079, 0.015, 1.000, 0.905 и 0.005, соответственно, что хорошо согласуется с экспериментальными данными.

Таким образом, модельная молекулярная структура в виде комплекса - и -субъединиц может служить адекватной моделью потенциал-зависимого калиевого /-канала в открытом состоянии.

Для построения модели потенциал-зависимого калиевого /-канала в закрытом состоянии мы исходили из следующих предположений (рис. 11):

1) потенциал-зависимый калиевый /-канал представляет собой потенциал-зависимый фермент с активными участками в -субъединице, локализованными на расстоянии 30-35 от оси канала и содержащие NADP+-кофакторы;

2) при связывании фермента с молекулой субстрата происходят конформационные изменения в -субъединице, что в свою очередь приводит к конформационным изменениям в -субъединице.

Изменение конформации канала за счет связывания с молекулой субстрата может быть причиной формирования закрытого для ионов /канала. При этом возможны два не исклю- Рис. 14А. Профили свободной энергии в области селективночающих друг друга го фильтра и центральной полости -субъединицы закрытого /-канала случая: «разбухание» молекулы канала и поворот отдельных полярных субъединиц в составе -субъединицы при изменении разности потенциалов на концах мембраны, что приводит к изменению положения отдельных субъединиц Рис. 14Б. Профили свободной энергии в области нижней посубъединицы. Учитыры -субъединицы и поры -субъединицы закрытого /канала вая, что экспериментальные данные по структуре субстрата отсутствуют, нами проведено исследование зависимости ионной проводимости от диаметра /-канала. Мы исследовали зависимость JX = JX(n), где n – отношение диаметра открытого канала к диаметру конформационно модифицированного канала с шагом 0.1.

Для расчета ионных токов, отношений коэффициентов проницаемости и проводимости канала мы использовали подход, который применяли для исследования открытого /-канала. При этом предполагали, что вследствие малости молекулы субстрата, его поле дает пренебрежимо малый вклад в энергетические профили.

В результате проведенных расчетов установлено, что при n = 1.8, т.е.

уменьшении диаметра почти в 2 раза, наблюдается достаточно малое значение тока ионов калия через канал: JK = 0.076 пА. В табл. 1 представлены значения + ионных токов при различных значениях n.

Таблица Ионные токи ( JX ) при различных значениях отношений ( n ) диаметров открытого и конформационно модифицированного потенциал-зависимого калиевого /канала 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.n 0.016 0.014 0.012 0.010 0.008 0.006 0.004 0.002 0.0JLi, пА + 0.081 0.072 0.063 0.054 0.045 0.036 0.027 0.017 0.0JNa, пА + 1.030 0.810 0.690 0.570 0.450 0.330 0.210 0.090 0.0JK, пА + Для объяснения причин падения калиевого тока практически до значений, соизмеримых с натриевым током канала, обратимся к профилям свободной энергии канала, представленных, как и в случае открытого канала, для трех последовательных интервалов изменения координаты оси Z: области селективного фильтра и центральной полости субъединицы (рис.

Рис. 15. ВАХ закрытого /-канала 14A), области нижней поры -субъединицы и поры -субъединицы (рис. 14Б).

Существенное различие Giwc = Giwc(Z) открытого и закрытого канала наблюдается только в области сужения поры -субъединицы. При этом высоты барьеров для различных ионов находятся в следующей последовательности K+

Результаты расчета ВАХ закрытого потенциал-зависимого калиевого /канала в условиях симметричных монокатионных растворов ([I] = [I] = 0.04 М) представлены на рис. 15. Данная связь показывает сущестL R вование линейной зависимости между током и напряжением на участке 0–60 мВ с малыми величинами проводимости одиночного канала: для K+ 1.27 пСм, для Na+ 0.20 пСм, для Li+ 0.016 пСм, для Rb+ 1.05 пСм, для Cs+ 0.005 пСм, что соответствует закрытому состоянию потенциал-зависимого калиевого канала.

Таким образом, переход потенциал-зависимого калиевого /-канала из открытого в закрытое состояние осуществляется при связывании молекулы субстрата с -субъединицей канала, сопровождающийся конформационной перестройкой канала при изменении разности потенциалов на концах мембраны.

В результате предложенная и теоретически обоснованная нами модельная структура /-канала хорошо согласуется с экспериментально наблюдаемой структурой гомологичного канала Kv 1.2.

Подобный подход мы использовали и для исследования потенциалзависимого калиевого канала Kv1.2 типа Shaker из Rattus norvegicus, для которого получили хорошее согласие экспериментальных и расчетных функциональных характеристик.

В третьей главе проведено исследование структуры и функциональных характеристик хирально модифицированных модельных каналов с инвариантной и модифицированной природной аминокислотной последовательностью.

Долгое время считалось, что хиральная чистота биосферы носит абсолютный характер, т.е. биологически важные реакции в живых организмах происходят только с участием L-аминокислот и D-сахаров.

Однако хиральные антиподы природных органических соединений играют существенную роль в биохимии и физиологии всех организмов – от бактерий до млекопитающих. Например, D-Ser является нейромодулятором, связывающимся с центром связывания NMDA-рецептора нервных клеток млекопитающих. Компоненты клеточной стенки бактерий зачастую содержат L-углеводы и остатки Dаминокислот. Данные остатки также содержат некоторые пептидные антибиотики. В нервных клетках высших организмов находят D-Ala, D-Asp и D-Ser, в некоторых случаях в значительных концентрациях. Однако все, что относится к рибосомальному синтезу полипептидов, характеризуется абсолютной хиральной чистотой: полипептиды содержат остатки только L-аминокислот, а нуклеиновые кислоты – только D-сахара.

Вопрос о биологической роли гомохиральности этих важнейших биополимеров относительно прост. Так, гомохиральность белков и нуклеиновых кислот определяет их стереоспецифичность – необходимое условие матричного синтеза, а также обусловливает стабильность их структур, обеспечивающих их функционирование. Но, несмотря на значительные успехи, достигнутые в этой области, биологические основы того, что белки-ферменты и нуклеиновые кислоты имеют строго определенный знак хиральности, остаются неизвестными.

Нам представляется, что ответ на последний вопрос необходимо искать, в частности, в исследовании влияния (LD)-преобразования аминокислотных остатков на структурные и функциональные характеристики ионных каналов.

Возможны два способа построения пространственной структуры каналов из D-аминокислот.

1. Построение модельного канала полным зеркальным отражением природного канала. В этом случае получаем канал из D-аминокислот с преобразованием торсионных углов всех аминокислот вида - и -. Следствием этого будет, например, преобразование всех правых -спиралей в левые. Не вызывает сомнений, что «отраженный» канал ни чем, кроме направления вращения спиралей и направления скрученности -структур из-за скрученности отдельных -тяжей, не будет отличаться от природного. Неизменной будет и потенциальная энергия молекулы канала и его функциональные характеристики. Поэтому построение и исследование функционирования таких хирально модифицированных каналов не представляет интереса.

2. Построение модельного канала заменой всех L-аминокислот на Dаминокислоты при сохранении природной вторичной структуры канала. Такая замена эквивалентна замене бокового радикала R на H-атом, стоящий при углероде аминокислоты. В результате, при сохранении природной вторичной структуры в молекуле модельного канала появляются значительные стерические напряжения, снятие которых приведет к изменению его третичной и четвертичной структуры, а также функциональных характеристик. Поэтому хирально модифицированные каналы, полученные по данной схеме, представляют наибольший интерес в исследовании их структуры и функциональных характеристик.

Следует отметить, что появление стерических напряжений является вполне обоснованным, т.к. углы и модифицированных аминокислот в основном попадают в запрещенные области карты Рамачандрана.

Стерические напряжения в канале после замены L-аминокислот на Dаминокислоты снимали методами молекулярной динамики в интервале 10 пс при шаге 0.001 пс. При расчете функции потенциальной энергии молекулы мы использовали представление и параметризацию силового поля AMBER. Данный выбор обоснован тем, что силовое поле AMBER было параметризовано для исследования структуры и динамики белков и нуклеиновых кислот. Для исследования функциональных характеристик хирально модифицированных модельных каналов использовали подход, применявшийся нами для исследования природных калиевых каналов.

D-аминокислотные ионные каналы с инвариантной первичной структурой.

Результаты численного моделирования молекулярной динамики каналов показывают, что зависимости потенциальной энергии молекулы канала от времени характеризуются наличием множества локальных минимумов, причем по нашим наблюдениям, каждый из них соответствует пору-формирующей конформации молекулы как природного, так и хирально модифицированного канала.

В табл. 2 представлены результаты исследований структуры и функциональных характеристик хирально модифицированных модельных каналов: отношение наиболее глубокого локального минимума природного канала к соответствующему минимуму его хирально модифицированного изомера ( UL D ), отношение среднего радиуса поры D-аминокислотного канала (D-канала) к радиусу поры его природного аналога ( R ), ионные проводимости (gI ) и токи ( JI ) D L D-канала при =60мВ.

Таблица Структурные и функциональные характеристики D-аминокислотных каналов с инвариантной первичной структурой UL D R gI, пСм JI, пА Канал D L Li+ 18.533 Li+ 0.0Na+ 146.366 Na+ 0.1D-KcsA 0.99 1.4 K+ 459.700 K+ 1.5Rb+ 401.883 Rb+ 1.1Cs+ 3.850 Cs+ 0.0Li+ 3.683 Li+ 0.2Na+ 31.267 Na+ 1.8D-KvAPo 1.01 1.2 K+ 405.305 K+ 24.3Rb+ 318.900 Rb+ 19.1Cs+ 3.483 Cs+ 0.2Li+ 0.216 Li+ 0.0Na+ 0.866 Na+ 0.0D-KvAPc 1.01 1.2 K+ 12.850 K+ 0.7Rb+ 5.766 Rb+ 0.3Cs+ 0.716 Cs+ 0.0Li+ 2.717 Li+ 0.1Na+ 7.200 Na+ 0.4D-/o 1.012 1.05 K+ 174.267 K+ 10.4Rb+ 164.083 Rb+ 9.8Cs+ 2.533 Cs+ 0.1Li+ 0.383 Li+ 0.0Na+ 2.600 Na+ 0.1D-/c 1.011 1.05 K+ 13.900 K+ 0.8Rb+ 12.800 Rb+ 0.7Cs+ 0.150 Cs+ 0.0Li+ 2.717 Li+ 0.1Na+ 5.667 Na+ 0.3D-Kv1.2o 1.001 1.07 K+ 99.783 K+ 5.9Rb+ 79.083 Rb+ 4.7Cs+ 1.583 Cs+ 0.0Li+ 2.717 Li+ 0.0Na+ 5.667 Na+ 0.0D-Kv1.2c 1.002 1.07 K+ 99.783 K+ 0.0Rb+ 79.083 Rb+ 0.0Cs+ 1.583 Cs+ 0.0 Представленные в табл. 2 теоретические результаты наглядно демонстрируют, что полная потенциальная энергия хирально модифицированных и соответствующих природных каналов совпадает, а изомеризация аминокислот каналов приводит к увеличению радиуса поры. Кроме того, хирально модифицированный изомер канала KcsA не является калий-избирательным с большими значениями ионных токов, что характерно и для открытых D-каналов KvAP, / и Kv1.2. Хирально модифицированные изомеры закрытых каналов KvAP, / и Kv1.2 обладают проводимостями и токами, практически совпадающими с таковыми для их природных изомеров. Этот результат позволяет считать, что хирально модифицированные изомеры закрытых потенциал-зависимых каналов на самом деле является не закрытыми, а открытыми потенциал-зависимыми калиевыми каналами.

Подобные же исследования нами проведены для NR1-центра связывания NMDA-рецептора в комплексе с Gly, D-Ser и D-cSer. В результате численного моделирования молекулярной динамики было установлено, что комплекс природного NR1-центра связывания NMDA-рецептора и природных D-лигандов энергетически более стабилен, чем комплекс природного NR1-центра связывания NMDA-рецептора и неприродных L-лигандов. Напротив, комплекс хирально модифицированного NR1-центра связывания NMDA-рецептора и неприродных L-лигандов энергетически почти эквивалентен комплексу природного NR1центра связывания NMDA-рецептора и природного D-лиганда.

Возможно, эта функциональная, а не энергетическая неэквивалентность стереоизомеров пептидов могла играть важную роль в возникновении гомохиральности строго определенного знака белков на уровне отбора наиболее совершенных структур в ходе эволюции.

D-аминокислотные ионные каналы с модифицированной первичной структурой.

Замена всех L-аминокислот природного канала на соответствующие Dаминокислоты при сохранении природной первичной и вторичной структуры приводит к изменению основных функциональных характеристик и потери его калиевой избирательности. Такие результаты делают настоятельно необходимым рассмотреть возможность изменения природной первичной структуры каналов до получения третичной структуры хирально модифицированного модельного канала с природными функциональными характеристиками.

Для построения хирально модифицированных модельных каналов с природными функциональными характеристиками нами предложен метод «энергетического выравнивания» третичных структур каналов с различными аминокислотными последовательностями.

В основу метода положены следующие предположения:

1) структурно гомологичные L- и D-аминокислотные каналы имеют близкие распределения энергий аминокислотных остатков;

2) функционально гомологичные L- и D-аминокислотные каналы содержат соответствующие аминокислотные остатки, принадлежащие определенной родственной группе аминокислот.

Метод включает следующую последовательность действий:

1) для третичной структуры приРис. 16. Распределение абсолютных значений разности энергий аминокислотных остатков природного и неоптимиродного канала расзированного хирально модифицированного канала считываются энергии взаимодействия каждой аминокислоты с остальными аминокислотами и строится распределение энергии взаимодействия всех Lаминокислот канала;

2) подобное распределение энерРис. 17. Распределение абсолютных значений разности энергий аминокислотных остатков природного и хирально гии аминокислот модифицированного канала с модифицированной аминорассчитывается для кислотной последовательностью, полученной энергетическим выравниванием структур соответствующего хирально модифицированного модельного канала с природной первичной структурой без оптимизации его геометрии;

3) сравнением полученных распределений энергии L- и D-аминокислот, определяются D-аминокислоты, для которых разность соответствующих энергий принимает наибольшие значение;

4) наиболее напряженные D-аминокислоты заменяют D-аминокислотами, для которых разность энергий взаимодействия будет минимальной;

5) в полученном хирально модифицированном канале с модифицированной первичной структурой методами молекулярной динамики снимают остаточные стерические напряжения.

Замену L- на D-аминокислоты проводили исключительно в пределах родственных групп аминокислотных остатков: с алифатическими боковыми цепями;

с боковыми цепями, содержащими гидроксильную группу; с боковыми цепями, содержащими атомы серы; с боковыми цепями, содержащими кислые группы или их амиды; с боковыми цепями, содержащими основные группы; содержащие ароматические кольца и иминокислоты.

В результате энергетического выравнивания получается хирально модифицированный модельный канал энергия, геометрия поры, энергетические профили и функциональные характеристики которого пренебрежимо мало отличаются от таковых соответствующего природного канала.

Распределение абсолютных значений разности энергий аминокислотных остатков природного канала KcsA и неоптимизированного его хирально модифицированного изомера представлено на рис. 16. Диаграмма показывает, что в некоторых аминокислотных остатках существуют значительные стерические напряжения, достигающие 88000 ккал/моль. Очевидно, что данное значение энергии, как и многие другие значения энергии D-аминокислот, значительно превышает среднее значение энергии пептидной связи, что определяет принципиальную невозможность существования такого полипептида и необходимость использования энергетического выравнивания для снятия значительных стерических напряжений в полипептиде.

Диаграмма, представленная на рис. 17, показывает распределение абсолютных значений разности энергий L-аминокислотных остатков природного и хирально модифицированного модельного канала с модифицированной аминокислотной последовательностью, полученной энергетическим выравниванием структур. В этом случае замена значительно напряженных аминокислотных остатков в неоптимизированном хирально модифицированном изомере приводит к появлению ненапряженной, по сравнению с природной структурой, третичной структуры хирально модифицированного канала KcsA. Ниже представлена аминокислотная последовательность хирально модифицированного AATGRGGGAGSVIGAAGAGAGCGGAGIADGGAVGADVASSAKGAHHAGASASSAGYGDGASGSI HGHCVGVVAGAAGISSVGAVSAAGASHFVGREQ и природного канала KcsA.

ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWG RCVAVVVMVAGITSFGLVTAALATWFVGREQ Подобный подход нами использовался для построения молекулярных структур хирально модифицированных изомеров каналов KvAP, /, Kv1.2 и NR1 активного центра NMDA-рецептора. В табл. 3 представлены результаты исследований структуры и функциональных характеристик, полученных энергетическим выравниванием хирально модифицированных каналов.

Таблица Структурные и функциональные характеристики D-аминокислотных каналов с модифицированной первичной структурой UL D R gI, пСм JI, пА Канал D L Li+ 0.23 Li+ 0.0Na+ 1.65 Na+ 0.1D-KcsA 0.857 1.07 K+ 26.37 K+ 1.5Rb+ 18.88 Rb+ 1.1Cs+ 0.02 Cs+ 0.0Li+ 0.083 Li+ 0.0Na+ 0.035 Na+ 0.0D-KvAPo 0.923 1.05 K+ 11.68 K+ 0.7Rb+ 10.03 Rb+ 0.6Cs+ 0.15 Cs+ 0.0Li+ 0.005 Li+ 0.00Na+ 0.003 Na+ 0.00D-KvAPc 0.934 1.04 K+ 0.093 K+ 0.00Rb+ 0.065 Rb+ 0.00Cs+ 0.002 Cs+ 0.000Li+ 0.005 Li+ 0.0Na+ 0.53 Na+ 0.0D-/o 0.871 1.02 K+ 1.1 K+ 1.0Rb+ 0.98 Rb+ 1.0Cs+ 0.01 Cs+ 0.0Li+ 0.05 Li+ 0.0D-/c 0.869 1.Na+ 0.053 Na+ 0.0K+ 1.1 K+ 0.0Rb+ 0.98 Rb+ 0.0Cs+ 0.012 Cs+ 0.00Li+ 0.32 Li+ 0.0Na+ 0.56 Na+ 0.0D-Kv1.2o 0.901 1.01 K+ 10.75 K+ 0.6Rb+ 6.63 Rb+ 0.3Cs+ 0.02 Cs+ 0.0Li+ 0.002 Li+ 0.00Na+ 0.02 Na+ 0.0D-Kv1.2c 0.889 1.01 K+ 0.06 K+ 0.00Rb+ 0.03 Rb+ 0.00Cs+ 0.002 Cs+ 0.00 Представленные в табл. 3 результаты позволяют утверждать, что радиус поры и функциональные характеристики хирально модифицированных каналов практически совпадают с таковыми для соответствующих природных каналов.

При этом хирально модифицированные каналы энергетически более стабильны, чем соответствующие природные каналы (хирально модифицированные каналы примерно в 1.2 раз энергетически более стабильны, чем существующие природные каналы).

В отличие от калиевых каналов, в результате подобных исследований структуры хирально модифицированного NR1-центра связывания NMDAрецептора нами установлено, что комплекс природного NR1-центра связывания NMDA-рецептора и природных D-лигандов энергетически более стабилен, чем комплекс хирально модифицированного NR1-центра связывания NMDAрецептора и неприродных L-энантиомеров лиганда. Так для лигандов Gly, Ser и cSer разность энергий комплексов составляет 134.18 ккал/моль, 148.29 ккал/моль и 145.04 ккал/моль, соответственно.

Молекулярный комплекс хирально модифицированного NR1-центра связывания NMDA-рецептора и природных D-лигандов энергетически менее стабилен, чем комплекс природного NR1-центра связывания NMDA-рецептора и природного D-лиганда. Для лигандов Gly, Ser и cSer разность энергий комплексов составляет 1457.05 ккал/моль, 1443.05 ккал/моль и 1447.99 ккал/моль, соответственно. Данный результат существенно отличается от результата, полученного для хирально модифицированных калиевых каналов с модельной первичной структурой. Нам представляется вполне очевидным, что для получения значения энергии комплекса хирально модифицированного центра связывания NMDAрецептора с L-лигандом согласующейся с энергией комплекса природного центра связывания NMDA-рецептора и природного лиганда, необходимо, кроме модификации первичной структуры рецептора, использование другого лиганда.

Данное обстоятельство обусловлено тем, что, в отличие от иона, лиганд центра связывания NMDA-рецептора является более сложной (многоцентровой) молекулярной структурой.

Последний результат, возможно, означает, что в биосфере, которая использует D-аминокислоты и L-сахара, совершенно другими были бы клеточные рецепторы и их субстраты. Следовательно, совершенно другой была бы и вся биохимия клеточных процессов, связанных с рецепцией.

Для исключения возможных артефактов метода энергетического выравнивания нами проверены коммутативность операций зеркального отражения и минимизации полной энергии молекулы. Проведено решение обратной задачи построения методом энергетического выравнивания структуры природного канала из структуры хирально модифицированного модельного канала с природными функциональными характеристиками. В результате функциональные характеристики модельного и природного канала достаточно хорошо согласуются друг с другом (абсолютная ошибка составляет не более 3%), а метод энергетического выравнивания можно считать надежным методом построения хирально модифицированных каналов с природными функциональными характеристиками.

Подобная коммутативность нами проверена также для грамицидинового канала – одного из наиболее хорошо изученных каналов, сформированным пептидным антибиотиком грамицидином А. Грамицидин синтезируется в ходе Sматричного синтеза, который широко распространен у бактерий. При S-матричном синтезе пептидов, возникшем на гораздо более поздних стадиях эволюции, чем синтез рибосомальный, могут использоваться нестандартные аминокислоты, в том числе и D-аминокислоты. В результате проведенного расчета установлено, что расхождение отношений коэффициентов проницаемостей хирально модифицированного и природного грамицидинового канала составляет не более 2%, что подтверждает выполнение коммутативности рассмотренных операций.

Нам представляется, что в ходе предбиологической эволюции могли сформироваться белки, построенные из D-аминокислот, но с первичной структурой, отличной от существующей природной структуры белков. Не вызывает сомнений, что в этом случае для обеспечения матричного синтеза Dаминокислотных белков нуклеиновые кислоты будут построены из L-сахаров.

Следует отметить, что существование биосферы, которая использует Dаминокислоты и L-сахара, согласуется с выводами традиционной теории спонтанного нарушения зеркальной симметрии и существуют достоверные данные о взаимодействии аминокислот и нуклеиновых кислот различной хиральности.

Если сравнить D-аминокислотные последовательности модельных каналов, сохранивших природную функциональность, то несложно установить варианты преобразований L-аминокислот в D-аминокислоты (рис. 18). Причем это единственная схема преобразований, позволяющая получать хирально модифицированные модельные каналы с природной функциональностью.

GLGD ALAD SLSD CLCD DLDD NLND KLKD HLHD FLFD PLPD LLGD VLAD TLSD МLCD ELDD QLND RLKD WLHD YLFD ILGD Рис. 18. Преобразование L-аминокислот в D-аминокислоты сохраняющее природную функциональность ионных каналов Таким образом, любой D-аминокислотный канал может быть построен в виде комбинации 10 аминокислот (G, A, S, C, D, N, K, H, F, P) и, соответственно, для их синтеза вполне достаточной была бы дублетная таблица Dаминокислотного генетического кода, кодирующая не более 15 аминокислот.

Нам представляется, что именно ионные каналы как молекулярные посредники формирования ионной асимметрии клеток – необходимого условия их стабильности, возможно, являются наиболее ранними белками.

Возможно, на более поздних этапах эволюции D-аминокислотных белков, в процессе увеличения разнообразия структур и функций белков, в матричный синтез могли бы быть включены другие D-аминокислоты, что привело бы к усложнению генетического кода до триплетного и увеличению разнообразия структур и функций белков.

Вопрос о возможном эволюционном возникновении большего разнообразия используемых в биосинтезе аминокислот может быть решен на основе теории коэволюции (Wong,1975). При этом полный анализ взаимодействия факторов эволюции, которое могло бы привести к переходу на триплетный код и к использованию набора из 20 D-аминокислот в рибосомальном синтезе белков, выходит за рамки настоящей работы.

В четвертой главе рассмотрены структурные и функциональные характеристики ионных каналов, содержащие остатки D-Asp и iAsp появление которых может быть обусловлено посттрансляционными неферментативными модификациями остатков L-Asn и L-Asp in vivo.

Вплоть до 70-х годов прошлого века считалось, что все белки живых организмов состоят из L-аминокислотных остатков. Однако экспериментально было установлено, что со временем наблюдается увеличение содержания остатков DAsp и iAsp в различных тканях организма человека и животных. Позднее было установлено, что данные аминокислотные остатки являются продуктами реакции посттрансляционной неферментативной модификации остатков L-Asp и LAsn в белках.

Отмечено появление остатков D-Asp в белках больных болезнью Альцгеймера, Паркинсона, при склеротических изменениях в сердечно-сосудистой системе, при глазной катаракте и т.д., а также в очень медленно обновляющихся белках в норме, таких как коллаген, дентин и др.

Если появление остатков D-Asp характерно для очень медленно обновляющихся белков в норме и белков организма в патологическом состоянии, то появление iAsp характерно даже для медленно обновляющихся белков. Последнее связано с тем, что время жизни медленно обновляющихся белков превышает время образования остатков iAsp в этих белках. Образование D-Asp более длительный процесс при нормальных физиологических условиях.

Относительная частота содержания остатков D-Asp и (или) iAsp в белках с временем жизни T0 является решением дифференциального уравнения x(D)iAsp -Xxx & xiAsp = v(D)iAsp -, (7) -Xxx -Xxx CAsx CAsx -Xxx с периодическими начальными условиями x(D)iAsp (nT0 )= 0, n = 0, 1, 2, 3, …., -Xxx характеризующими процесс обновления и деградации белков.

Здесь x(D)iAsp = X(D)iAsp CAsx – отношение количества остатков D-Asp -Xxx -Xxx и (или) iAsp к общему количеству остатков Asx3, CAsx-Xxx – количество остатков Asx в фрагментах Asx-Xxx аминокислотной последовательности, v(D)iAsp-Xxx – скорость образования остатков D-Asp и iAsp из остатков Asx в зависимости от следующего за Asx остатка Xxx аминокислотной последовательности, n – определяет периодичность процесса обновления белка.

Относительная частота содержания остатков (D)-iAsp в одиночном белке, определяемая с помощью решения (7), имеет следующий вид v(D)iAsp-Xxx x(D)iAsp = (t - nT0 ). (8) c - c expAsx-Xxx Asx-Xxx Xxx Xxx CAsx-Xxx В зависимости (8) cAsx-Xxx = CAsx-Xxx CAsx – относительная частота содержания фрагментов Asx-Xxx в аминокислотной последовательности белков.

Экспериментальному и теоретическому исследованию содержания остатков D-Asp и их влияния на функциональные характеристики очень медленно обновляющихся белков посвящено большое количество работ (см. обзор Ritz-Time et al., 2002). Напротив, практически отсутствуют работы посвященные исследованию содержания остатков iAsp и их влиянию на функциональные характеристики белков с T0 >1 v, что характерно для большинства медленно обновляющихся белков, таких как ионные каналы.

В последнем случае представляет несомненный интерес исследование зависимости среднего, по совокупности белков организма, значения xiAsp от t для медленно обновляющихся белков c T0 = const и белков с T0 = f(t) имеют следующий вид (рис. 19 и 20). Появление T0 = f(t) обусловлено экспериментально установленным увеличением времени жизни белков с возрастом (Ward, 2000).

Для построения x = x (t) с использованием (8) величины c опреiAsp iAsp Asn-Xxx деляли по результатам статистического анализа 17704 Asn-содержащих аминокислотных последовательностей из Банка белковых структур, величины v iAsp-Xxx – по результатам регрессионного анализа, в котором в качестве независимой переменной использовали разность полных энергий дипептидов iAsp-Xxx и AsnXxx.

Для удобства, под Asx понимается один из остатков Asp или Asn Зависимость, представленная на рис. 19 показывает, что x имеет поiAsp стоянное значение на протяжении жизни организма и составляет примерно 12%.

Следовательно, даже в медленно обновляющихся белках возможно отличное от нуля содержание iAsp на протяжении жизни организма и это содержание не меняется с возрастом. График, представленный на рис. 20 наглядно демонстрирует, что учет T = T (t) в выражении (8) приводит возрастающей зависимости 0 x = x (t), даже для медленно обновляющихся белков.

iAsp iAsp Таким образом, представляет несомненный интерес исследование структурных и функциональных характеристик калийизбирательных каналов, в коРис. 19. Зависимость x = x (t) для белков с T0 = const iAsp iAsp торых проведена замена остатков Asn на iAsp. Кроме того, важность таких исследований обусловлена существованием экспериментально установленных Рис. 20. Зависимость x = x (t) для белков с T0 = f(t) iAsp iAsp (Погорелов и др., 2006) возрастных изменений содержания Na+ и K+ в мышечной клетке сердца, которые сопряжены с нарушениями в работе ионных каналов.

Результаты наших расчетов показали, что замена остатков Asn на iAsp в каналах приводит к уменьшению (в среднем в 1,2 раза) их энергетической стабильности. При этом если разность значений энергии соответствующих открытых и закрытых немодифицированных потенциал-зависимых ионных каналов может компенсироваться изменением разности потенциалов на концах мембраны, то для соответствующих модифицированных каналов такие компенсации весьма затруднительны. Вполне возможно, данный результат указывает на то, что изменения знака разности потенциалов на концах мембраны или недостаточно для перехода модифицированных калиевых каналов из открытого состояния в закрытое или требуют большего времени для такого перехода.

Для модифицированных каналов наблюдается существование линейной зависимости между током и напряжением на участке 0-60 мВ с величинами проводимостей, незначительно отличающимися от проводимостей немодифицированных ионных каналов. Так, например для модифицированного канала KcsA g = 0.16 пСм, g = 2.42пСм, g = 33.15пСм, g = 31.41пСм и Li+ Na+ K+ Rb+ g = 0.20 пСм. При этом для всех модифицированных каналов наблюдается неCs+ значительное (порядка 0.1пА) увеличение ионных токов и неизменность отношений коэффициентов проницаемостей.

Таким образом, в результате старения организма может происходить увеличение ионных токов потенциал-зависимых калиевых каналов мембраны при сохранении свойства их калиевой избирательности.

Неферментативная рацемизация играет существенную роль в патогенезе болезней характерных для людей пожилого возраста. Так отмечено появление DAsp в белках больных болезнью Альцгеймера и Паркинсона. Вместе с тем существуют данные о вовлечении NMDA-рецепторов в патофизиологические процессы при указанных хронических заболеваниях. Поэтому представляет интерес исследование влияния остатков D-Asp в NR1-центре связывания NMDA-рецептора на взаимодействие с лигандами.

Молекулярно-динамическим моделированием мы определяли устойчивые конфигурации комплексов D-аминокислотных лигандов с модифицированным (NR1D-Asp), содержащим остатки D-Asp, и немодифицированным NR1-центром связывания NMDA-рецептора.

На рис. 21 представлены равновесные энергии ( E ) связывания Dаминокислотных лигандов с NR1- и NR1D-Aspцентром связывания. Значения E для комплексов лигандов Gly, D-Ser, D-Asn, DThr и NR1-центра связывания принадлежат интервалу 80–1ккал/моль, слеРис. 21. Равновесные энергии связывания D-лигандов с немодовательно, дандифицированным и модифицированным NR1-центром связывания ные лиганды наиболее прочно связываются с NR1. Этот результат согласуется с результатами кристаллографических исследований молекулярных основ стереоспецифичности связывания Gly и D-Ser (Furukawa et al., 2003) и дает возможность использовать молекулярно-динамическое моделирование в исследовании взаимодействия Dлигандов c NR1D-Asp-центром связывания. Другие D-аминокислоты менее прочно связываются с NR1, а для D-Leu характерно отталкивание.

Неферментативная модификация аминокислотных остатков NR1-центра связывания приводит к увеличению количества D-лигандов, значение E которых, принадлежит интервалу 80–100 ккал/моль. Это Gly, D-Ala, D-Asn, D-Ile, DLeu, D-Pro, D-Ser, D-Thr. Отличительной особенностью данной совокупности аминокислот, является появление алифатических неполярных аминокислот DAla, D-Leu, D-Ile и D-Pro в качестве лигандов.

Таким образом, из всех возможных комбинаций аминокислот, наиболее стабильными являются молекулярные комплексы немодифицированного NR1центра связывания с Gly, D-Ser, D-Asn и D-Thr. Наиболее стабильными являются молекулярные комплексы NR1D-Asp-центра связывания рецептора с Gly, D-Ala, D-Asn, D-Ile, D-Leu, D-Pro, D-Ser и D-Thr. Причем, для модифицированного NR1-центра связывания характерно наличие дополнительных алифатических аминокислотных лигандов: D-Ala, D-Leu, D-Ile и D-Pro. Следовательно, D-Ala, D-Leu, D-Ile и D-Pro можно рассматривать в качестве дополнительных эффективных лигандов NR1-центра связывания NMDA-рецептора в патологии.

ВЫВОДЫ 1) Модифицирован и теоретически обоснован комбинированный квантово-классический метод применительно к расчету энергетических профилей ионов в поре канала. Получено соответствие теоретических и экспериментальных значений функциональных характеристик каналов, определены значения функциональных характеристик ранее экспериментально не исследованных модифицированных каналов. Установлено, что расстояние между ионом и атомами поры канала, на котором возможно разделение квантовой и классической составляющей энергии, составляет 4.2. Для калиевого канала в виде комплекса - и субъединиц предложена и теоретически обоснована модельная структура, которая согласуется с экспериментально наблюдаемой структурой гомологичного потенциал-зависимого калиевого канала Kv 1.2.

2) Хирально модифицированные модельные каналы с природной первичной структурой имеют относительно большой диаметр поры канала и не являются калий-избирательными каналами. При этом их полная потенциальная энергия совпадает с энергией соответствующих природных каналов.

3) Разработанный и теоретически реализованный метод построения хирально модифицированных каналов с природными функциональными характеристиками, основанный на энергетическом выравнивании третичных структур каналов с различными аминокислотными последовательностями, позволил получить молекулярные структуры хирально модифицированных каналов с функциональными характеристиками соответствующих природных каналов. При этом модельные каналы строятся из 10 D-аминокислотных остатков и являются энергетически более стабильными, чем соответствующие природные каналы.

4) Формирование остатков iAsp может быть значимым процессом не только для очень медленно обновляющихся белков, но и для медленно обновляющихся белков, таких как ионные каналы. Теоретически прогнозируется, что появление остатков iAsp в калиевых ионных каналах приведет к уменьшению их энергетической стабильности, незначительному увеличению ионных токов при сохранении их калиевой избирательности.

5) Гипотетическое появление остатков D-Asp в NR1-центре связывания NMDA-рецептора, обусловленное патофизиологическими процессами при хронических заболеваниях пожилого возраста, способно привести к увеличению числа связываемых алифатических аминокислотных лигандов (D-Ala, D-Leu, DIle и D-Pro), что не свойственно для немодифицированного NR1-центра связывания.

СПИСОК ОСНОВНЫХ РАБОТ ПО ТЕМЕ ДИССЕРТАЦИИ Статьи в рецензируемых научных журналах по списку ВАК 1. Исаева Г.А., Дмитриев А.В., Исаев П.П. Механизм местной анестезии: ориентационные эффекты на дальних расстояниях // Биофизика, 2000, Т.45, №6, с.

1066–1071.

2. Исаева Г.А., Дмитриев А.В., Исаев П.П. Поляризационные взаимодействия в системе анестетик-биомембрана: активность производных ацетанилида // Журнал физической химии, 2001, Т.75, №10, с. 1716–1720.

3. Исаева Г.А., Дмитриев А.В., Исаев П.П. Анализ количественных соотношений структура - анестезирующая активность ацетанилидов с применением регрессионных и квантовохимических методов // Химико-фармацевтический журнал, 2001, Т.35, №6, с. 54–56.

4. Исаева Г.А., Дмитриев А.В., Исаев П.П., Зайнутдинов А.В., Рожков А.Н.

Влияние базиса на точность оценки дипольного момента молекулы ацетанилида // Журнал структурной химии, 2001, Т.42, №6, c. 1222–1225.

5. Дмитриев А.В., Исаева Г.А., Исаев П.П., Барышников В.Г., Ласточкин А.В.

Уровни энергии и волновые функции иона в грамицидиновых каналах // Биофизика, 2002, Т.47, №5, с. 864–868.

6. Исаева Г.А., Дмитриев А.В., Исаев П.П. Взаимодействие местных анестетиков с модельными ионными каналами // Биофизика, 2002, Т.47, №3, с. 506– 511.

7. Исаева Г.А., Дмитриев А.В., Исаев П.П. Моделирование поляризационных взаимодействий в системе спирт – биомембрана // Известия вузов. Сер. Химия и хим. технология, 2003, Т.46, №6, с. 101–103.

8. Дмитриев А.В., Твердислов В.А. О методах расчета распределения потенциала в белковых порах // Биофизика, 2004, Т.49, №3, с. 506–510.

9. Дмитриев А.В., Марков И.В., Барышников В.Г., Твердислов В.А. Об использовании приближенных силовых полей для расчета распределения электростатического потенциала мембранных каналов // Журнал структурной химии, 2005, Т.46, №5, с. 624–628.

10. Дмитриев А.В., Исаев П.П., Твердислов В.А. Разделение дальних и ближних взаимодействий в расчетах распределения энергии ионов в мембранных каналах // Журнал структурной химии, 2006, Т.47, №2, с. 255–259.

11. Дмитриев А.В., Марков И.В., Барышников В.Г., Твердислов В.А. Распределение энергии и ионная избирательность бактериального калиевого канала // Биофизика, 2006, Т.51, №4, с. 624–629.

12. Исаева Г.А., Дмитриев А.В., Исаев П.П. Влияние вязкости растворителя на молекулярную динамику грамицидинового канала // Известия вузов. Серия Химия и химическая технология, 2006, Т.49, №9, c. 40–42.

13. Дмитриев А.В., Марков И.В., Твердислов В.А. Моделирование ионной избирательности потенциал-зависимого калиевого канала // Технологии живых систем, 2006, Т.3, №4, с. 39–42.

14. Дмитриев А.В., Твердислов В.А. Моделирование последовательности кодонов белок-кодирующей области калиевого канала зеркальной клетки // Технологии живых систем, 2006, Т.3, №5, с. 39–41.

15. Дмитриев А.В., Исаев П.П., Твердислов В.А. Влияние изомеризации аминокислотных остатков на структуру аквапорина // Журнал структурной химии, 2006, Т.47, №3, с. 578–580.

16. Дмитриев А.В., Марков И.В., Твердислов В.А. Рацемизация бактериального калиевого канала и хиральная безопасность биосферы // Технологии живых систем, 2006, Т.3, №1, с. 5–8.

17. Дмитриев А.В., Марков И.В., Твердислов В.А. Структура и ионная избирательность открытого потенциал-зависимого калиевого канала // Журнал структурной химии, 2007, Т.48, №1, с. 143–145.

18. Коротина А.С., Дмитриев А.В., Марков И.В., Твердислов В.А. Изменение структуры аквапорина в результате биологического старения организма // Известия вузов. Сер. Химия и хим. технология, 2007, Т.50, №5, с. 128–129.

19. Коротина А.С., Дмитриев А.В., Марков И.В., Твердислов В.А. Применение смешанных энергетических профилей ионов в расчетах токовых характеристик калиевого мембранного канала // Известия вузов. Сер. Химия и хим.

технология, 2007, Т.50, №6, с. 115–116.

20. Коротина А.С., Дмитриев А.В., Твердислов В.А. Моделирование лигандов нативного и хирально модифицированного NR1-центра связывания NMDAрецептора // Биомедицинская химия, 2008, Т.50, №4, с. 415–416.

Статьи в других журналах, изданиях и тематических сборниках 21. Исаева Г.А., Дмитриев А.В., Исаев П.П. Математическое моделирование межмолекулярных взаимодействий в системе анестетик-биомембрана // Вестник КГУ им. Н.А. Некрасова, 2000, Т.2, №2, с. 50–55.

22. Исаева Г.А., Дмитриев А.В., Николаевский В.А., Исаев П.П. Дескрипторы молекулярной формы в исследованиях местноанестезирующей активности производных фенилпропиофенона // Прикладные информационные аспекты медицины, 2000, Т.3, №2, с. 46–50.

23. Дмитриев А.В., Исаев В.П., Исаева Г.А., Казак Е.В. Молекулярное моделирование ионных потоков через функциональную мембрану // Вестник КГУ им.

Н.А. Некрасова, 2002, №2, с. 8–13.

24. Дмитриев А.В., Исаева Г.А., Исаев П.П., Лузянин С.Е. Исследование ионных потоков через границу раздела раствор/мембрана // Конденсированные среды и межфазные границы, 2002, Т.5, №3, с. 35–40.

25. Dmitriev A.V., Baryshnikov V.G., Markov I.V., Tverdislov V.A. Band and point statistical estimation of channelforming polypeptides potential / Progress in Chemometrics Research. 2005. USA, NY: Nova Science Publishers, P.30–45.

26. Дмитриев А.В., Твердислов В.А. О возможности существования и структурных особенностях зеркального антипода природной клетки // Препринт физического факультета МГУ им. М.В. Ломоносова, № 6/2005. Москва, 2005. с.

27. Дмитриев А.В., Исаев П.П. Физическое объяснение водной проницаемости аквапорина AP1 // Вестник КГУ им. Н.А. Некрасова, 2005, Т.5, №4, с. 17–20.

28. Дмитриев А.В., Исаев П.П. Представление молекулы мембранного канала в системе координат с поворотной осью симметрии // Вестник КГУ им. Н.А.

Некрасова, 2005, Т.5, №7, с. 4–7.

29. Твердислов В.А., Яковенко Л.В., Дмитриев А.В., Жаворонков А.А., Твердислова И.Л. Происхождение предшественников живой клетки. О двух фундаментальных асимметриях – ионной и хиральной / Проблемы регуляции в биологических системах. Биофизические аспекты / Под общей ред. А.Б. Рубина. Москва-Ижевск: Институт компьютерных исследований, 2007. с. 259– 291.

В материалах конференций 30. Дмитриев А.В., Зайнутдинов А.В., Рожков А.Н., Ткаченко К.Н., Исаева Г.А., Исаев П.П. Механизм местной анестезии: модельные взаимодействия в системе анестетик-мелиттин // Труды молодых ученых России: Сборник материалов 3-го Всероссийского медицинского конгресса. Ижевск: Изд-во Экспертиза, 2000. с. 16–18.

31. Исаева Г.А., Дмитриев А.В., Исаев П.П., Зайнутдинов А.В., Рожков А.Н. Математическое моделирование электростатических взаимодействий в системе анестетик-биомембрана // Математика. Образование. Экология. Гендерные проблемы: Тезисы докладов Международной конференции. Воронеж: Изд-во ВГУ, 2000, с. 54–55.

32. Исаева Г.А., Дмитриев А.В., Исаев П.П., Зайнутдинов А.В., Рожков А.Н., Ткаченко К.Н. Математическое моделирование взаимодействий местных анестетиков с грамицидиновыми каналами биомембраны // Физика и радиоэлектроника в медицине и экологии: Тезисы докладов 4-я Международной научно-технической конференции. Владимир: Изд-во Ин-та оценки природ. ресурсов, 2000, с. 47–52.

33. Дмитриев А.В., Исаева Г.А., Исаев П.П. Математическое моделирование межмолекулярных взаимодействий в системе анестетик-биомембрана // Биохимическая физика на рубеже столетий: Тезисы докладов международной конференции. Москва: Изд-во Института биохимфизики РАН, 2000. с. 42.

34. Исаева Г.А., Дмитриев А.В., Исаев П.П., Зайнутдинов А.В., Рожков А.Н.

Влияние внешней среды на равновесную геометрию грамицидинового канала // Математика. Компьютер. Образование: Тезисы докладов 8-й Международной конференции. Москва: Изд-во Прогресс-Традиция, 2001. с. 285.

35. Дмитриев А.В., Зайнутдинов А.В., Рожков А.Н., Исаева Г.А., Исаев П.П.

Влияние внешней среды на структурируемость HHSH-конформера грамицидина А // Молекулярная физика неравновесных систем: Материалы 3-й Всероссийской научной конференции. Иваново: Изд-во ИГХТУ, 2001. с. 52–56.

36. Дмитриев А.В., Исаева Г.А., Исаев П.П., Слукина Ю.Л. Квантовомеханическая модель движения иона в грамицидиновом канале мембраны // Компьютерное обеспечение химических исследований: Тезисы докладов Международного симпозиума. Москва: Изд-во ИОХ РАН, 2001. с. 49–50.

37. Зайнутдинов А.В., Рожков А.Н., Исаева Г.А., Дмитриев А.В., Исаев П.П. Моделирование равновесной геометрии аминокислот во внешнем электростатическом поле // Компьютерное обеспечение химических исследований: Тезисы докладов Международного симпозиума. Москва: Изд-во ИОХ РАН, 2001. с.

59–60.

38. Dmitriev A., Isaeva G., Isaev P. Analysis of residuals: statistical method in QSAR studies // Abstracts of the 7th Scandinavian Symposium on Chemometrics. 2001, V.3, p. 20–22.

39. Исаева Г.А., Дмитриев А.В., Казак Е.В., Кузьминова Р.В., Исаев П.П. Математическое моделирование физиологического отклика в системе анестетикмембрана // XVIII Съезд физиологического общества им. И.П. Павлова: Тезисы докладов. Казань: Изд-во КГМУ, 2001. c. 104–105.

40. Лузянин С.Е., Дмитриев А.В., Исаева Г.А., Исаев П.П. Теоретическое и экспериментальное исследование ионных потоков через мембрану // Биология – наука 21-го века: Тезисы докладов 6-й Пущинской конференции молодых ученых. – Пущино: Изд-во ПНЦ, 2002. с. 32.

41. Дмитриев А.В., Барышников В.Г., Лузянин С.Е. О конфигурациях электростатического поля в ионных каналах мембран // Биохимическая физика: тезисы докладов 2-й ежегодной молодежной конференции ИБХФ-ВУЗы. Москва:

Изд-во ИБХФ РАН, 2002. с. 4.

42. Дмитриев А.В., Барышников В.Г. О движении ионов в порообразующих белковых молекулах // Молекулярное моделирование: тезисы докладов 3-й Всероссийской конференции. - Москва: Изд-во ГЕОКХИ РАН, 2003. с. 9–10.

43. Мелихов Н.Д., Шмелев Р.В., Дмитриев А.В., Барышников В.Г. О распределении молекулярного электростатического потенциала в полости порообразующих белков // Молекулярное моделирование: тезисы докладов 3-й Всероссийской конференции. - Москва: Изд-во ГЕОКХИ РАН, 2003. с. 94–95.

44. Исаева Г.А., Исаев В.П., Дмитриев А.В. Квантовохимическое исследование проводимости ионных каналов биологических мембран // Молекулярная биология, химия и физика гетерогенных систем: Материалы 7-й Международной конференции, Москва-Плес. 2003. Иваново: Изд-во ЮНОНА, 2003. с. 49–54.

45. Дмитриев А.В., Барышников В.Г., Марков И.В., Твердислов В.А. О механизмах ионной избирательности калиевого канала // 3-й Съезд биофизиков России: тезисы докладов. Воронеж: Изд-во ВГУ, 2004. с. 209–210.

46. Исаева Г.А., Шмелев Р.В., Исаев П.П., Дмитриев А.В., Лапшина Н.П. Моделирование биологической активности местноанестезирующих и антиаритмических препаратов // 3-й Съезд биофизиков России: тезисы докладов. Воронеж: Изд-во ВГУ, 2004. с. 525–526.

47. Дмитриев А.В., Марков И.В., Твердислов В.А. Моделирование третичной структуры функционально эквивалентных изомеров трансмембранных белков // 4-я Всероссийская конференция "Молекулярное моделирование": тезисы докладов. Москва, 2005. с. 35–37.

48. Марков И.В., Дмитриев А.В. Разделение дальних и ближних взаимодействий в расчетах распределения энергии в аксиально-симметричных мембранных каналах // Международная конференция «Ломоносов-2005»: тезисы докладов.

Москва, 2005. с. 40–41.

49. Марков И.В., Дмитриев А.В. Предсказание первичной и третичной структуры D-изомеров модельных белков функционально эквивалентных природным мембранным белкам // Международная конференция «Ломоносов-2005»: тезисы докладов. Москва, 2005. с. 42-44.






© 2011 www.dissers.ru - «Бесплатная электронная библиотека»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.