WWW.DISSERS.RU

БЕСПЛАТНАЯ ЭЛЕКТРОННАЯ БИБЛИОТЕКА

   Добро пожаловать!


На правах рукописи

ЖАРКОВ Дмитрий Олегович

СТРУКТУРНЫЕ И ДИНАМИЧЕСКИЕ АСПЕКТЫ ФУНКЦИОНИРОВАНИЯ ДНК-N-ГЛИКОЗИЛАЗ В ПРОЦЕССЕ ЭКСЦИЗИОННОЙ РЕПАРАЦИИ ОСНОВАНИЙ ДНК

03.00.04 — биохимия

Автореферат диссертации на соискание ученой степени доктора биологических наук

Новосибирск — 2008

Работа выполнена в Институте химической биологии и фундаментальной медицины СО РАН

Официальные оппоненты: доктор биологических наук, профессор, чл.-корр. РАН Кочетков Сергей Николаевич доктор химических наук, профессор Лаврик Ольга Ивановна доктор биологических наук, профессор, чл.-корр. РАН Нетесов Сергей Викторович

Ведущая организация: Институт молекулярной генетики РАН

Защита состоится «18» сентября 2008 г. в 1000 ч.

на заседании диссертационного совета Д 003.045.01 при Институте химической биологии и фундаментальной медицины СО РАН по адресу:

630090, г. Новосибирск, пр. Лаврентьева,

С диссертацией можно ознакомиться в библиотеке Института химической биологии и фундаментальной медицины СО РАН Автореферат разослан «___» ___________ 2008 г.

Ученый секретарь диссертационного совета к.х.н., доцент В.В. Коваль

ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ

Актуальность проблемы. Ежедневно около 100000 звеньев молекул ДНК каждой клетки человеческого организма повреждаются в результате разнообразных эндогенных и экзогенных генотоксических воздействий. Повреждение ДНК может приводить к появлению мутаций, провоцировать гибель клетки или ее злокачественное перерождение. Для предотвращения таких последствий в клетке существует несколько взаимодополняющих систем ферментативных процессов, носящих общее название «репарация ДНК». На текущий момент известно 6 главных систем репарации, отличающихся друг от друга используемыми субстратами, ферментами и механизмами устранения повреждения. При реактивации поврежденные основания ДНК непосредственно превращаются в нормальные без расщепления ДНК и последующего ее синтеза. Все остальные системы репарации действуют с деградацией поврежденной части ДНК и синтезом нового участка, замещающего деградированный. В ходе рекомбинационной репарации поврежденная ДНК исправляется за счет рекомбинации с полноценной копией генетического материала. Двуцепочечные разрывы также могут лигироваться в процессе воссоединения негомологичных концов. Неканонические пары оснований и короткие гетеродуплексы узнаются системой репарации гетеродуплексов, которая удаляет включающий их фрагмент длиной до нескольких сотен дезоксирибонуклеотидов (dN) и застраивает образовавшуюся брешь. Для эксцизионной репарации нуклеотидов, субстратами которой являются объемные аддукты в ДНК, также характерно вырезание участка ДНК с последующим синтезом, но, в отличие от предыдущего случая, участок синтеза ограничен несколькими десятками dN. Нарушение механизмов репарации ДНК приводит к различным патологическим процессам, в число которых входят канцерогенез, дефекты развития и старение.

Наиболее распространенные типы повреждений ДНК — одноцепочечные разрывы (ОЦР), апурин-апиримидиновые сайты и поврежденные основания — репарируются с помощью эксцизионной репарации оснований. При повреждении оснований ДНК этот процесс инициируется ферментами ДНК-гликозилазами, которые гидролизуют N-гликозидную связь между поврежденным основанием и дезоксирибозным фрагментом. У всех живых организмов имеется несколько ДНКгликозилаз с разной субстратной специфичностью; так, в клетках человека на сегодня известно 11 ДНК-гликозилаз, а у Escherichia coli — 8 таких ферментов. Некоторые из них обладают весьма узкой субстратной специфичностью, удаляя из ДНК поврежденные основания только одного вида (например, урацил), другие же могут выщеплять разнообразные поврежденные основания, относящиеся в целом к одному классу (например, окисленные пиримидины). Исходя из их последовательностей и пространственных структур, ДНК-гликозилазы можно разделить на несколько семейств, не родственных друг другу. Тем не менее, некоторые ДНК-гликозилазы, относящиеся к разным семействам, могут использовать в качестве субстрата одни и те же поврежденные ДНК.

До сих пор не решен вопрос, каким образом ДНК-гликозилазы дискриминируют субстратные и несубстратные азотистые основания. Многие поврежденные азотистые основания отличаются от канонических всего одним или несколькими атомами, поэтому фермент должен с исключительной точностью выбирать выщепляемое основание из огромного избытка неповрежденных звеньев ДНК. С другой стороны, многие поврежденные азотистые основания могут быть очень похожими на основания, выщепляемые какой-либо ДНК-гликозилазой, но не использоваться ею в качестве субстрата. Известны также многие случаи, когда ДНК-гликозилазы могут выщеплять какие-либо основания из олигодезоксирибонуклеотидов (ОДН), но не из высокомолекулярной ДНК; такие субстраты считаются «неспецифичными» для данной гликозилазы. Ясно, что связывание субстратного основания в активном центре фермента должно предваряться его селекцией среди других оснований, которые в принципе могут, но не должны служить субстратами. Изучение механизмов селекции субстратов чрезвычайно актуально как для углубления знаний о репарации ДНК, так и для понимания механизма действия ферментов и создания ферментов с заданными свойствами.

Для исследования ДНК-гликозилаз применяются самые передовые подходы физико-химической биологии. Структура ряда ДНК-гликозилаз установлена методами рентгеноструктурного анализа (РСА) и ядерного магнитного резонанса.

Создан большой набор модифицированных звеньев ДНК, позволяющий анализировать закономерности узнавания поврежденных оснований. Современные молекулярно-биологические методы позволяют получать формы белков с измененной структурой и анализировать их свойства. Однако несмотря на это, остается большой редкостью комбинированный подход к изучению ДНК-гликозилаз, который сочетал бы различные взаимодополняющие структурные и биохимические методы в систематическом исследовании механизмов узнавания этими ферментами поврежденных оснований.

Основной целью данной работы являлось установление закономерностей и механизмов узнавания и расщепления поврежденной ДНК гликозилазами в процессе эксцизионной репарации ДНК.

Для достижения поставленной цели было необходимо решить следующие задачи:

• Определить структуры ДНК-гликозилаз, ранее не охарактеризованные в литературе, в комплексе с ДНК и в свободном состоянии;

• Дополнить структурные данные компьютерными моделями динамического поведения фермент-субстратных комплексов и проанализировать консервативность физико-химических свойств аминокислотных остатков в ключевых участках пространственной структуры ДНК-гликозилаз;

• Исследовать активность ДНК-гликозилаз по отношению к разным видам поврежденной ДНК, термодинамические и кинетические параметры взаимодействия этих ферментов с ДНК;

• Проследить изменение конформации ДНК-гликозилаз в ходе катализа и установить природу конформационных переходов;

• Исследовать влияние замен различных аминокислотных остатков на активность и субстратную специфичность ДНК-гликозилаз;

• Изучить динамику перераспределения ДНК-гликозилаз в эукариотической клетке в ответ на генотоксический стресс.

Научная новизна и практическая ценность работы. В настоящей работе для исследования функционирования ДНК-гликозилаз использован комплекс взаимодополняющих физико-химических, расчетных и биохимических методов, в результате чего были установлены многие факторы, определяющие механизм действия и субстратную специфичность нескольких ДНК-гликозилаз бактерий и млекопитающих.

В работе впервые определены структуры эндонуклеазы VIII из E. coli (Nei) в свободном состоянии и в комплексе с ДНК, структура формамидопиримидин-ДНКгликозилазы из E. coli (Fpg) в комплексе с ДНК и структура эндонуклеазы V бактериофага T4 (DenV) в ковалентном комплексе с ДНК. Промоделированы взаимодействия поврежденного основания в активных центрах Nei и Fpg.

Установлены функции ряда аминокислотных остатков в процессе расщепления поврежденной ДНК, катализируемой этими ферментами. Впервые исследована активность 8-оксогуанин-ДНК-гликозилазы млекопитающих (OGG1) по отношению к ряду модифицированных оснований ДНК и влияние на нее ионов металлов.

Установлены многостадийные кинетические схемы узнавания повреждений Fpg и Nei.

На основании этих данных предложена модель узнавания поврежденных оснований ДНК-гликозилазами как многоступенчатого процесса.

В ходе работы открыта новая группа эукариотических ДНК-гликозилаз, гомологичных Nei и Fpg. Установлено, что одна из этих ДНК-гликозилаз, NEIL1, обладает уникальной субстратной специфичностью по отношению к некоторым окисленным пиримидиновым основаниям, а также поврежденным основаниям, расположенным вблизи ОЦР, и что ее инактивация повышает чувствительность клеток к ионизирующему излучению. На основании сравнительного анализа функций и последовательностей Fpg, Nei и их гомологов обосновано предложение об их выделении в отдельное суперсемейство ДНК-гликозилаз.

Установлено, что цитоплазматическая фракция некоторых ферментов репарации (OGG1, NEIL2, ДНК-полимераза ) связывается с микротрубочками, что может способствовать их быстрой релокализации в ответ на генотоксический стресс.

Все представленные данные оригинальны и вносят существенный вклад в решение проблемы узнавания поврежденной ДНК ферментами репарации.

В процессе работы созданы штаммы E. coli для экспрессии нескольких ДНКгликозилаз и методики выделения этих белков, потенциально применимых как в области прикладной генетической токсикологии (например, для кометографии), так и для усиления защитно-репарационных систем человека при окислительном стрессе разной природы. Получены антитела к 8-оксогуанин-ДНК-гликозилазе млекопитающих, которые могут использоваться для анализа уровня этого белка в клетках человека при оценке их репарационного статуса. Структуры ДНК-гликозилаз бактериальной природы, определенные в работе, могут использоваться как основа для разработки ингибиторов этих ферментов, важных для выживания патогенных бактерий в организме.

Материалы диссертационной работы используются в учебном процессе кафедры молекулярной биологии Новосибирского государственного университета при чтении курсов «Молекулярная биология», «Мутагенез и репарация ДНК» и «Горячие точки молекулярной биологии», а также при выполнении дипломных и кандидатских диссертационных работ в ИХБФМ СО РАН.

Апробация работы. Результаты работы были представлены на VII международном симпозиуме по радиационным повреждениям ДНК (Орлеан, Франция, 2001), XXXII съезде Европейского общества мутагенов в окружающей среде «DNA damage and repair: Fundamental aspects and contribution to human disorders» (Варшава, Польша, 2002), XCIII съезде Американского общества онкологических исследований (Сан-Франциско, США, 2002), III международной конференции «Биоинформатика регуляции и структуры генома» (Новосибирск, 2002), конференциях «Albany Conversation» (Олбани, США, 2003, 2005, 2007), II конгрессе организации «Протеом человека» и XIX съезде Международного союза биохимии и молекулярной биологии (Монреаль, Канада, 2003), международной конференции «Targeting RNA: Artificial ribonucleases, conformational traps and RNA interference» (Новосибирск, 2003), VI международной конференции по процессам узнавания нуклеиновых кислот (NACON VI, Шеффилд, Великобритания, 2004), международной конференции «Chemical and biological problems of proteomics» (Новосибирск, 2004), XXX конгрессе Федерации европейских биохимических обществ и IX конференции Международного союза биохимии и молекулярной биологии (Будапешт, Венгрия, 2005), международной конференции «Химическая биология» (Новосибирск, 2005), IX международном симпозиуме по радиационным повреждениям ДНК (Анталья, Турция, 2006), международной конференции «Физико-химическая биология», посвященной 80-летию со дня рождения акад. Д.Г. Кнорре (Новосибирск, 2006) и III международной конференции «Фундаментальные науки — медицине» (Новосибирск, 2007) Публикации. По материалам диссертации опубликовано 28 научных статей в 2000–2007 гг. Список публикаций приведен в конце автореферата.

Структура работы. Диссертационная работа состоит из введения, литературного обзора, сводки материалов и методов, описания результатов исследований и их обсуждения (всего 5 подразделов), заключения, выводов и списка цитируемой литературы. Работа изложена на 386 страницах машинописного текста и содержит рисунков и 17 таблиц. Список цитируемой литературы содержит 790 источников.

СОДЕРЖАНИЕ РАБОТЫ

Все ДНК-гликозилазы расщепляют N-гликозидную связь поврежденного dN по механизму нуклеофильного замещения. В соответствии с природой нуклеофила эти ферменты делятся на два класса. Монофункциональные ДНК-гликозилазы используют в этом качестве молекулу воды и расщепляют только N-гликозидную связь, образуя апурин-апиримидиновый (AP-) сайт. Бифункциональные гликозилазы в качестве нуклеофила используют аминогруппу самого фермента, при этом образуется интермедиат — ковалентный ДНК-белковый комплекс (основание Шиффа), и наряду с выщеплением основания катализируется последующий разрыв цепи ДНК по механизму -элиминации (AP-лиазная активность), а в некоторых случаях (Fpg, Nei) — ,-элиминации, что ведет к образованию однонуклеотидной бреши, по обе стороны от которой расположены фосфатные группы.

В качестве основных объектов исследования были выбраны ферменты Fpg и Nei из E. coli, которые по своим последовательностям относятся к отдельному семейству ДНК-гликозилаз, четко отличающемуся от всех других. Достаточно высокая гомология Fpg и Nei при значительном расхождении их субстратной специфичности делают эту пару ферментов идеальной моделью для установления механизмов узнавания поврежденной ДНК. На первом этапе исследования было необходимо установить структуру этих ДНК-гликозилаз как в свободном виде, так и в комплексе с ДНК, поскольку структура Nei неизвестна, а для Fpg доступна только структура фермента из T. thermophilus в свободном состоянии. Для установления структуры комплексов Fpg и Nei с ДНК применяли сшивку ферментов с ДНК при помощи NaBH4, который восстанавливает основание Шиффа до стабильного амина. Помимо Fpg и Nei, была также установлена пространственная структура ковалентного комплекса ДНК с DenV, поскольку этот фермент относится к другому структурному суперсемейству, но также несет N-концевой нуклеофильный остаток и таким образом вместе с Fpg и Nei может использоваться для сравнительного анализа общих механизмов узнавания и расщепления поврежденной ДНК.

Пространственная структура некоторых ДНК-гликозилаз Пространственная структура комплекса Nei•ДНК Для ковалентной сшивки белка Nei с ДНК были выбраны двуцепочечные ОДН типов: в одном из комплексов ДНК содержала либо 4 основания Thy (комплекс Nei•ДНК, окончательное разрешение структуры 1,42 , код PDB 1K3W), либо основания BrUra в тех же позициях (Nei•BrДНК, 1,25 , 1K3X) для определения структуры методом многоволновой аномальной дифракции. Общая структура комплекса Nei с ДНК показана на рис. 1. Фермент содержит два компактных домена, соединенные гибким линкером, а ДНК связана в широкой положительно заряженной бороздке между ними. N-концевой домен начинается с длинной -спирали, за которой следует структура двухслойного -сэндвича. C-концевой домен включает 5 спиралей, две из которых образуют консервативный мотив «спираль — два поворота — спираль» (H2TH). За -спиральным участком следует один цинковый палец шпилечной структуры.

В данном комплексе поврежденное основание удалено из ДНК, а соответствующий фрагмент дезоксирибозы раскрыт, восстановлен (дезоксирибитол, dRbl) и ковалентно присоединен атомом C1’ к остатку Pro1 белка (рис. 2). Молекула ДНК изломана на ~50° в месте поврежденного звена, ее малая бороздка значительно расширена.

Рис. 1. Общая структура комплекса Nei•ДНК. А — проекция, перпендикулярная длинной оси молекулы Nei. Б — проекция, перпендикулярная плоскости, в которой лежит молекула ДНК.

Специфичные ДНК-белковые взаимодействия, обнаруженные в комплексе Nei•ДНК, схематически показаны на рис. 3. Белок в основном взаимодействует с областью ДНК с 3’-стороны от повреждения, образуя несколько сильных водородных связей между высококонсервативными аминокислотными остатками, фосфатами p0, p–1, p–2 и p–3 поврежденной цепи и несколькими структурными молекулами воды.

Фосфатные группы, непосредственно соседствующие с фрагментом dRbl, координированы связями с Lys52, Asn168 и Arg252. Nei образует лишь несколько слабых связей с комплементарной цепью ДНК. Остатки мотивов H2TH и цинкового пальца вовлечены в обширную сеть водородных связей, организующую активный центр фермента (рис. 4).

Рис. 2. Крупный план области ковалентной сшивки Pro1–dRbl в комплексе Nei•ДНК.

Синим цветом показана экспериментально определенная OMIT-карта электронной плотности по уровню 3.

Находящееся напротив поврежденного звена основание Ade остается внутри спирали ДНК, где частично стабилизировано связью с остатком Gln69.

Выворачивание поврежденного dN оставляет в ДНК большую полость, в которую внедряются остатки Gln69, Leu-70 и Tyr71; последний вклинивается между A(0) и T(–1), способствуя излому ДНК.

Рис. 3. Схема взаимодействий Nei с ДНК. Точкой отсчета для нумерации нуклеотидов служит поврежденное звено, индексы в скобках описывают нуклеотиды комплементарной цепи.

Водородные связи обозначены стрелками в направлении от донора к акцептору.

В структуре Nei•ДНК отсутствовало выщепленное основание Thy(OH)2. Также из-за размытой электронной плотности не удалось определить конформацию участка, включающего а.к.о. 215–222. Этот участок («отсутствующая петля») также не определяется в структурах ковалентных комплексов мутантных форм Nei с ДНК и Fpg•ДНК (см. ниже). Возможное расположение остатков фермента, принимающих участие в узнавании поврежденного основания, устанавливали методами структурнобиоинформатического анализа и компьютерного моделирования (см. ниже).

На основании известных биохимических данных предполагается, что каталитический механизм Nei и Fpg состоит из следующих шагов. Протонирование поврежденного основания (донором протона 1) превращает его в хорошо уходящую группу. Депротонирование атома N[Pro1] (акцептором 1) инициирует нуклеофильную атаку им по атому C1’. Протонирование атома O4’ (донором 2) и удаление второго протона с атома N[Pro1] (акцептором 2) приводит к образованию основания Шиффа и выщеплению поврежденного основания. Далее протекают последовательные реакции - и -элиминации, для первой из которых необходимо депротонирование C2’ (акцептор 3) и протонирование уходящего фосфата p–1 (донор 3), а для второй — депротонирование C4’ (акцептор 4) и протонирование уходящего фосфата p0 (донор 4). Природа доноров и акцепторов протонов и стереохимия отдельных стадий реакции пока неизвестны; структура Nei•ДНК дает представление о некоторых из них.

Положение и ориентация остатка Pro1 согласуются с направлением нуклеофильной атаки вдоль связи C1’–O4’. Важное значение для механизма может иметь водородная связь O2[Glu2]–O4’[dRbl] (рис. 4); остаток Glu2 протонирует атом O4’ (донор-2), инициируя раскрытие цикла дезоксирибозы и фиксируя его в положении, оптимальном для последующих стадий реакции. На стадии -элиминации атом N[Lys52] оптимально расположен для того, чтобы отдавать протон уходящему фосфату p–1 (донор 3), а гуанидиновая группа остатка Arg252, вероятно, участвует в протонировании или электростатической стабилизации уходящего фосфата p0 на стадии -элиминации (донор 4). Остаток Arg252 также образует сильную водородную связь (2,75 ). Хотя поблизости от атомов C2’ и C4’ не наблюдается остатков, которые могли бы выступать в качестве акцепторов 3 и 4, одним из возможных опосредованных водными мостиками акцепторов может служить Glu2. Ориентация заместителей по отношению к связи C2’–C3’ свидетельствует, что при элиминации протона pro-S-2’ должен образовываться цис-,-ненасыщенный альдегидный продукт.

Рис. 4. Взаимодействия между остатками активного центра Nei и атомами ДНК в районе поврежденного звена.

Около водородных связей приведена их длина в .

Пространственная структура комплекса Fpg•ДНК Фермент Fpg гомологичен ферменту Nei, но узнает другой набор поврежденных оснований. Для сравнительного анализа узнавания поврежденной ДНК Fpg и Nei была определена пространственная структура фермента Fpg в комплексе с ДНК (Fpg•ДНК, 2,10 , 1K82).

По общей структуре белок Fpg напоминает белок Nei. В структуре можно выделить два домена, соединенные линкером, N-концевой домен содержит 8 складок, образующих -сэндвич, параллельно боковым сторонам которого располагаются 2 -спирали. C-концевой домен содержит 4 -спирали, из которых две образуют мотив H2TH, и 2 -складки, образующие цинковый палец. Выщепленное основание 8-оксогуанина (8-oxoGua) в кристаллической структуре также отсутствует.

Конформация фрагмента dRbl, вывернутого из двойной спирали, зафиксирована ковалентной связью C1’–N[Pro1] и водородной связью с абсолютно консервативным остатком Glu2. Центр связывания молекулы ДНК и ее конформационное искажение в случае белка Fpg очень близки к наблюдаемым в комплексе Nei•ДНК. Значение среднеквадратичного смещения (r.m.s.d.) при суперпозиции N-концевых доменов составляет 1,53 , C-концевых доменов — 1,51 , а полных структур — 1,75 .

Большее значение r.m.s.d. в последнем случае связано с несколько отличающейся взаимной ориентацией доменов.

При взаимодействии Fpg с ДНК между ними образуется обширная сеть водородных связей (рис. 5), в которой участвуют остатки всех петель, обращенных к ДНК, в результате чего область контакта имеет площадь 2512 2, что значительно превышает контактную площадь в комплексе Nei•ДНК (860 2), но сравнимо с сообщавшейся в литературе контактной площадью в комплексе OGG1-ДНК (2268 2).

Fpg в основном образует связи с поврежденной цепью ДНК с 3’-стороны от поврежденного звена (фосфатные группы p0, p–1 и p–2) с участием консервативных остатков Lys56, His70, Asn168, Tyr236 и Arg258. Остатки Lys56 и Arg2расположены идеально для протонирования или электростатический стабилизации уходящих фосфатных групп p–1 и p0. С комплементарной цепью взаимодействует ограниченное число аминокислотных остатков белка, из которых консервативен только остаток His89.

Рис. 5. Схема взаимодействий Fpg c ДНК. Точкой отсчета для нумерации нуклеотидов служит поврежденное звено, индексы в скобках описывают нуклеотиды комплементарной цепи.

Водородные связи обозначены стрелками в направлении от донора к акцептору.

Выворачивание фрагмента dRbl и выщепление поврежденного основания приводит к образованию полости между цепями ДНК, в которой располагаются остатки Met73, Arg108 и Phe110. Боковая группа Phe110 интеркалирует между основаниями Cyt(1) и Cyt(0), внося излом в ДНК. Cyt(0) внутри спирали стабилизируется водородными связями с Arg108, что объясняет специфичность Fpg по отношению к этому основанию напротив поврежденного звена ДНК.

Остатки Pro1, Glu2, Glu5 и ряд других образуют глубокий карман, хорошо подходящий для связывания вывернутого 8-oxoGua. Однако локализовать выщепленное основание и «отсутствующую петлю» на картах электронной плотности оказалось невозможным. Для локализации центра связывания поврежденного основания, как и в случае Nei, использовали вычислительные методы (см. ниже).

Структура комплекса Fpg•ДНК объясняет многие известные биохимические данные для этого фермента. Сообщалось, например, что замены остатков Glu2, Glu5, Glu131 и Glu173 остатками Gln приводят к падению ДНК-гликозилазной, но не APлиазной активности Fpg. Исходя из структуры Fpg•ДНК, можно предположить, что остаток Glu2 протонирует положение O4’ и стабилизирует конформацию открытого углеводного цикла после выщепления основания. Возможная роль Glu5 заключается в фиксировании Glu2 в конформации, необходимой для катализа; кроме того, эти остатки входят в состав кармана для связывания 8-oxoGua. Glu131 образует водородные связи с Arg53, Arg54 и Ala55, что помогает зафиксировать закрытую конформацию белка, в которой N- и C-концевой домены сближены. Водородные связи, образуемые Glu173, стабилизируют поворот Gln234–Tyr236, который в свою очередь фиксирует конформацию Tyr236, образующего водородную связь с фосфатом p0. Способность всех вышеупомянутых остатков Glu к образованию водородных связей изменяется при их замене остатками Gln. Реакция расщепления ДНК по APсайту, скорее всего, менее чувствительна к отсутствию этих взаимодействий, поскольку нуклеофильная атака облегчена за счет повышенной конформационной свободы AP-сайта.

Таким образом, фермент Fpg близок по структуре к ферменту Nei, однако некоторые его структурные мотивы — в особенности интеркалирующие остатки и «отсутствующая петля» могут принимать участие в определении субстратной специфичности, которая отличается от субстратной специфичности Nei.

Пространственная структура белка Nei в свободном состоянии Структура фермента Nei в свободном состоянии неизвестна. Связывание ДНК может сопровождаться конформационными изменениями в молекуле Nei, которые могут вносить вклад в субстратную специфичность и каталитическую активность фермента. Поэтому представляло интерес сравнить структуры Nei в свободном и связанном с ДНК состоянии. Для определения структуры Nei в свободном состоянии использовали как фермент дикого типа (Nei-WT, 2,80 , 1Q39), так и его мутантные формы Nei-E2A (2,30 , 1Q3C) и Nei-R252A (2,05 , 1Q3B). Активность последних значительно снижена, однако их структуры практически не отличаются от Nei-WT.

Рис. 6. Наложение структур комплекса Nei•ДНК (белковая часть выделена зеленым) и Nei (выделена красным цветом) в свободном состоянии после суперпозиции по C-концевым доменам.

Глобальная конформация белка Nei в свободном состоянии заметно отличается от Nei в комплексе с ДНК, хотя общая двухдоменная организация и все элементы вторичной структуры сохраняются. Междоменная ДНК-связывающая бороздка в белке Nei в свободном состоянии значительно шире, чем в комплексе Nei•ДНК. Как видно из рис. 6, при суперпозиции C-концевых доменов Nei в свободном и связанном с ДНК состоянии наблюдается значительное различие в ориентации N-концевых доменов белка: связывание ДНК индуцирует поворот доменов на ~50° друг относительно друга. При этом происходит уменьшение угла раствора при вершине, находящейся на длинной оси молекулы Nei, и скручивание по длинной оси;

центральная точка обеих трансформаций лежит в начале междоменного линкера. В соответствии с принятой классификацией движения белковых доменов это движение относится к шарнирному типу, ранее не наблюдавшемуся для ДНК-гликозилаз.

Сближение N- и C-концевого доменов при связывании ДНК позволяет образовать между ними связи вне линкерного участка. Частично эти взаимодействия реализуются через водные мостики или через мостики с участием ДНК. В качестве примера можно привести сеть водородных связей, соединяющую остатки цинкового пальца (Arg252) и мотива H2TH (Asn168) в C-концевом домене с остатком Lys52 в Nконцевом домене. Очевидно, что катализ, для которого необходимо сближение остатков из разных доменов, может протекать только в закрытой форме Nei.

В структуре Nei в свободном состоянии также выявляются локальные, но функционально значимые изменения по сравнению с белковой частью комплекса Nei•ДНК. Например, во всех структурах Nei в свободном состоянии электронная плотность в районе N-концевого пептида PEGP4 и поворота, соединяющего складки цинкового пальца, размыта, что свидетельствует о множественности их конформаций, в отличие от комплекса Nei•ДНК, в котором конформация этих областей, участвующих в связывании ДНК, жестко зафиксирована. Вершина цинкового пальца сдвинута на ~4 по отношению к ее положению в комплексе Nei•ДНК. В то же время, во всех структурах Nei в свободном состоянии конформация «отсутствующей петли» определялась однозначно. Очевидно, что динамика данного участка полипептидной цепи отличается от динамики N-концевого пептида и цинкового пальца тем, что связывание ДНК приводит не к упорядочению, а к разупорядочению структуры, что может отражать гибкость, необходимую для диссоциации поврежденного основания без высвобождения ДНК из комплекса с ферментом.

Таким образом, сравнение структур белка Nei в свободном и связанном с ДНК состоянии выявляет глобальные и локальные конформационные изменения в молекуле фермента, которые приводят к сборке активного центра фермента.

Возможно, что эти конформационные переходы характерны для всех белков семейства Fpg/Nei.

Пространственная структура комплексов мутантных форм Nei•ДНК Как показывают структуры белка Nei и результаты сайт-направленного мутагенеза, остатки Glu2 и Arg252 играют важные, хотя и различающиеся роли в катализе. Однако они не оказывают влияния на структуру фермента в свободном состоянии, а при их замене Nei сохраняет способность узнавать и расщеплять APсубстраты (см. ниже). Для анализа влияния замен остатков Glu2 и Arg252 и компенсаторных механизмов, обеспечивающих сохранение активности фермента, была определена структура этих мутантных форм Nei в ковалентном комплексе с APдцОДН (Nei-E2Q•(AP)-ДНК, 2,60 ; Nei-R252A•(AP)-ДНК, 1,85 ). В качестве контроля и для сравнения координат реакций, начинающихся с разных типов поврежденной ДНК, параллельно установили структуру фермента Nei-WT с ОДН, в котором изначально отсутствовало поврежденное основание (Nei•(AP)-ДНК, 1,40 ).

Общая конформация комплексов была сходна для всех структур, полученных при сшивке разных форм белка Nei с AP-ОДН и в описанных выше структурах Nei•ДНК.

Значение угла излома ДНК для комплекса Nei-E2Q•(AP)-ДНК (58°) было выше, чем для остальных (43°–50°), что указывает на влияние замены E2Q на структуру области контакта ДНК с белком. Локальные конформационные различия между полипептидными частями комплексов Nei-ДНК в основном сосредоточены в начале N-концевой спирали, междоменном линкере, начале «отсутствующей петли» и верхушке цинкового пальца, которые, как показано выше, отличаются повышенной гибкостью.

Рис. 7. Конформация остатка Proв комплексах Nei•ДНК и Nei•(AP)ДНК (темная и светлая стержневые модели соответственно).

Рис. 8. Влияние замены R252A на структуру комплекса Nei•ДНК.

Суперпозиция структур Nei•(AP)ДНК (атомы углерода белка показаны темно-зеленым, а ДНК — темно-желтым цветом) и NeiR252A•(AP)-ДНК (светло-зеленый и светло-желтый цвет для атомов углерода белка и ДНК соответственно).

Каталитический нуклеофил Pro1 в комплексах Nei-WT с ДНК существует в разных конформациях (рис. 7). Выделяют «верхнюю» и «нижнюю» конформацию остатка Pro; Pro1 в комплексе Nei•ДНК находится в «верхней» конформации, а в комплексах Nei•(AP)-ДНК и Nei•BrДНК — в «нижней» и к тому же значительно развернут. Наличие альтернативных конформаций Pro1 означает, что даже в комплексе с ДНК эта часть активного центра сравнительно пластична. Напротив, остаток Glu2 находился в одной и той же конформации во всех комплексах Nei-WT с ДНК, сохраняя при этом водородную связь O2[Glu2]–O4’[dRbl].

Замены остатков Glu2 и Arg252 вызывали значительные локальные изменения конформации комплексов Nei•ДНК, в том числе на достаточно большом расстоянии от места замены. Замена E2Q приводила к потере взаимодействия O2[Glu2]– O4’[dRbl] и изменению конформации звена dRbl. При замене R252A происходила полная потеря образуемых Arg252 связей с фосфатными группами p0 и p–1 и значительному изменению конформация ДНК в области поврежденного звена (рис. 8).

Все исследованные замены также оказывали влияние на общую структуру цинкового пальца. Например, остаток Gln261, замена которого, по-видимому, ингибирует высвобождение продукта (см. ниже), в структурах Nei-WT и Nei-R252A образовывал связи с пептидными группами Leu-180 и Cys257, а замена E2Q на расстоянии 14 от Gln261 вызывала их разрыв. Некоторые различия также наблюдались в комплексах разных форм Nei в пределах интеркалирующей петли QLY71 и междоменного линкера белка. В частности, в разных структурах остаток линкера Arg124 существовал в нескольких конформациях, позволяющих предположить, что он может служить своеобразным «триггером», инициирующим переход белка из открытой формы в закрытую.

Активные центры ряда ферментов обладают пластичностью — свойством, позволяющим узнавать и превращать ряд отличающихся друг от друга субстратов и частично или полностью сохранять активность при заменах аминокислотных остатков. Пластичность активного центра — прямое следствие динамической структуры ферментов, молекулы которых образуют ансамбль практически изоэнергетических, быстро переходящих друг в друга конформаций. Пластичность чрезвычайно важна для эволюционной устойчивости каталитических свойств и для возникновения новых функций ферментов в ходе эволюции. Полученные данные по структуре белка Nei свидетельствуют о значительной пластичности его критически важных частей, образующих активный центр фермента.

Пространственная структура комплекса DenV•ДНК Как и в ферментах Fpg и Nei, в ферменте DenV в качестве нуклеофила используется -аминогруппа N-концевого аминокислотного остатка. Это указывает на сходство механизмов данных ферментов, хотя субстратная специфичность их значительно различается. Основным субстратом DenV служат циклобутановые пиримидиновые димеры (ЦПД), однако все три фермента могут расщеплять AP-ДНК.

В данной работе определена структура ковалентного комплекса DenV•(AP)-ДНК (2,30 , 2FCC), соответствующего интермедиату реакции — комплексу с основанием Шиффа (рис. 9).

Рис. 9. Общая структура ковалентного комплекса DenV•(AP)-ДНК. Звено A(0) выделено зеленым цветом.

Интересно, что вывернутое звено A(0) и связывающий его неглубокий карман принимают разные конформации в связывающих его центрах фермента в двух молекулах DenV•(AP)-ДНК в кристаллографической ячейке и в комплексе DenV/ЦПД-ДНК, что согласуется с отсутствием специфичности DenV к основанию напротив поврежденного звена. Остаток Arg21, занимающий межцепочечную полость, принимает разную конформацию во всех сравниваемых структурах.

Рис. 10. Схема взаимодействий DenV c ДНК. Точкой отсчета для нумерации нуклеотидов служит поврежденное звено, индексы в скобках описывают нуклеотиды комплементарной цепи.

Водородные связи обозначены стрелками в направлении от донора к акцептору.

Раскрытая форма dRbl стабилизирована водородной связью между O4’ и атомом O2[Glu22] (рис. 11А). Таким образом, Glu22 играет роль, аналогичную роли Glu2 в Fpg и Nei, а также каталитическому остатку Asp в ДНК-гликозилазах семейства эндонуклеазы III. До сих пор неизвестно, существует ли общий механизм отрыва протона от C2’ при -элиминации, катализируемой бифункциональными ДНКгликозилазами. На основании полученных структур ковалентных комплексов Nei, Fpg и DenV с ДНК можно предположить, что роль первичного акцептора протона выполняет атом O4’ раскрытого дезоксирибозного цикла. Поскольку углеводный фрагмент в раскрытой форме во всех этих структурах стабилизирован водородной связью между O4’ и карбоксильной группой (рис. 11Б), атом O4’ частично депротонирован, одна из его неподеленных электронных пар направлена к C2’ и не участвует в других взаимодействиях, а общая конфигурация углеводного фрагмента позволяет осуществить анти--элиминацию 3’-фосфатной группы.

Рис. 11. Возможные механизмы отрыва протона от атома C2’ на стадии -элиминации. А — окружение атома C2’ в структуре комплекса DenV•(AP)-ДНК. Б — суперпозиция активных центров структур DenV•(AP)-ДНК (обозначены красным и розовым цветами) и Nei•(AP)-ДНК.

Определенные структуры ДНК-гликозилаз вносят ясность в механизм узнавания и расщепления ими поврежденной ДНК. Однако отсутствие в структурах Fpg и Nei выщепленного поврежденного основания и неразрешенность области «отсутствующей петли» не дают однозначно установить способы взаимодействия поврежденного основания с центром его узнавания в молекуле фермента. Для уточнения природы этих связей и для выявления важных взаимодействий, не очевидных из структуры, использовали вычислительные методы.

Вычислительные подходы к идентификации критически важных аминокислотных остатков в ДНК-гликозилазах Структурно-биоинформатический подход Все известные ДНК-гликозилазы можно разделить на несколько семейств на основании их структуры и последовательности. С достаточной уверенностью можно предположить, что если группу ферментов с гомологичной последовательностью можно разделить на подгруппы с разной субстратной специфичностью, то позиции, консервативные во всех подгруппах, важны для общего каталитического механизма или для поддержания структуры белка, а позиции, которые консервативны внутри одной подгруппы, но не в других подгруппах («идиосинкразические» позиции) важны для функции, характерной только для данной подгруппы, и, в частности, могут определять субстратную специфичность входящих в нее ферментов. Такой подхода был использован для анализа функционально важных остатков в ДНК-гликозилазах Fpg и Nei.

Несмотря на структурное сходство и общую гомологию белков Fpg и Nei E. coli, их последовательности отличаются по многим позициям, в том числе находящимся в элементах структуры, важных для связывания ДНК и катализа. Поиском в базе данных GenBank были обнаружены 124 гомолога Fpg и 23 гомолога Nei. Остатки в выровненных последовательностях классифицировали с учетом их физикохимических свойств на консервативные, идиосинкразические и неконсервативные. В белках Fpg и Nei консервативные остатки расположены в основном в активном центре, цинковом пальце и гидрофобных ядрах обоих доменов (рис. 12).

Рис. 12. Структуры комплексов Nei•ДНК (А) и Fpg•ДНК (Б). Консервативные остатки выделены красным цветом, идиосинкразические — синим. B — остатки His89, Arg108, Arg109, Lys88, His91, Pro107 и Phe110 (выделены розовым), образующие седловой мотив в структуре Fpg•ДНК;

вид на комплекс с обратной стороны относительно рис. 12Б.

Идиосинкразические остатки в Fpg и Nei распределены асимметрично. В структуре Nei самый крупный их кластер расположен в N-концевом домене, окружая консервативное гидрофобное ядро и частично открываясь на краю ДНК-связывающей бороздки. В Fpg идиосинкразические остатки этого домена расположены на поверхности белка, но не в ДНК-связывающей бороздке. Два идиосинкразических кластера в районе предполагаемого центра связывания поврежденного основания в Fpg и Nei совершенно не совпадают. В структуре Nei кластер, включающий остатки Arg171, Leu-224, Arg226, Phe227, Phe230, Pro253 и Tyr255, располагается в Cконцевом домене рядом с активным центром и перекрывается с неглубоким карманом, где по данным компьютерного моделирования связывается основание Thy(OH)2 (см. ниже). В Fpg этого кластера нет совсем, но по соседству с консервативным активным центром в месте, где предположительно располагается вывернутое звено, находится кластер, образующий глубокий карман, состоящий из остатков Leu-3, Pro4, Glu5, Glu7, Arg53, Pro132, Ile169, Tyr170, Leu-205, Ile209, Gly213, Phe219 и Gly227.

Особый интерес среди идиосинкразических остатков Fpg представляют His89 и Arg108, а в Nei — Arg171. Arg108 Fpg входит в систему Met73–Arg108–Phe110, внедряющуюся в межцепочечную полость при выворачивании поврежденного звена.

His89 Fpg образует 2 водородных связи с сахарофосфатным остовом неповрежденной цепи ДНК и, возможно, участвует в ранних стадиях процесса узнавания повреждения.

В белке Nei остаток Arg171 образует связи с остатками поворота, соединяющего складки цинкового пальца. Также была проанализирована консервативность позиции, соответствующей остатку Lys217 Fpg, который по данным молекулярной динамики (см. ниже) может принимать участие в узнавании поврежденного основания в активном центре фермента. Хотя эта позиция не была абсолютно консервативной, с наличием основного аминокислотного остатка в ней коррелировало наличие основного аминокислотного остатка в позиции 109 (Arg109 Fpg). Интересно, что в структуре Fpg Arg109 расположен в непосредственной близости от His89 и образует контакты с неповрежденной цепью ДНК. Остатки His89 и Arg109 вместе с остатками Lys88, His91, Pro107, Arg108 и Phe110 образуют структуру в форме седла («седловой мотив»), которая препятствует связыванию ДНК в канонической B-форме и вызывает образование излома (рис. 12В).

Методы компьютерного моделирования По сравнению с биоинформатическими методами, компьютерное моделирование методами молекулярной динамики дает более прямой, но ресурсозатратный способ предсказывать взаимодействия в структурах биомакромолекул. Моделирование использовали для установления положения центра связывания поврежденного основания в Nei и для выявления аминокислотных остатков, взаимодействующих с разными поврежденными основаниями в активном центре фермента Fpg.

В ходе моделирования Nei в структуре белка был выявлен карман, находящийся в непосредственной близости от активного центра фермента и подходящий для связывания поврежденного основания. Он в основном образован ароматическими боковыми группами остатков Tyr169, Phe225, Phe227, Phe230, His231 и Tyr255. Эта структура геометрически комплементарна типичному субстрату Nei — основанию тимингликоля и ориентирует его для образования водородных связей с остатком Arg212.

Для детального анализа узнавания 8-oxoGua и других субстратов в активном центре Fpg проводили моделирование комплекса для оснований 8-oxoGua, Fapy-Gua, Fapy-Ade, 8-oxoAde и Gua, из которых первые три выщепляются ферментом, а последние два — нет. Звено 8-oxodGuo моделировали в 4 разных конформациях с разными значениями угла , 3 из которых соответствуют анти-конформации, и 1 — син-конформации, каждый из оставшихся dN моделировали в одной анти- и одной син-конформации. Для каждой системы значение r.m.s.d. по сравнению с начальной структурой было невелико, что свидетельствует о стабильности моделей. Вывернутое из ДНК основание во всех моделях было стабильно связано с активным центром фермента. Однако субстратные основания 8-oxoGua и в особенности Fapy-Gua в моделях с начальной син-ориентацией самопроизвольно поворачивались с приближением к значениям угла , характерным для анти-ориентации.

Рис. 13. Схема водородных связей, образуемых остатками активного центра Fpg с разными основаниями. Приведен процент времени 2-нс динамики, на протяжении которого существовала данная связь. А — анти-Gua, Б — син-Gua, В — анти-8-oxoGua 1, Г — анти-8-oxoGua 2, Д — син-8-oxoGua, Е — анти-Fapy-Gua, Ж — син-Fapy-Gua, З — анти-Fapy-Ade, И — син-Fapy-Ade, К — анти-8-oxoAde, Л — син-8-oxoAde.

Остатки Lys217 и Met73 образовывали стабильные связи со специфичными элементами поврежденных оснований. В моделях анти-8-oxoGua 1 и 3 наблюдалась водородная связь O8[8-oxoGua]–N[Lys217], а при моделировании звена 8-oxodGuo в начальной син-конформации, в которой эта связь невозможна, основание 8-oxoGua поворачивалось таким образом, чтобы образовать связь с остатком Lys217. В модели анти-8-oxoGua 2 вместо нее наблюдалась связь N7[8-oxoGua]–O[Met73] (рис. 13).

Субстратные основания Fapy-Gua и Fapy-Ade в анти-ориентации образовывали связи с Met73 с участием своих атомов N7 и N9. В случае Fapy-Gua они образовывались через разветвленный водный мостик, а в модели анти-Fapy-Ade — непосредственно с O[Met73] (рис. 13). Однако активный центр фермента практически не образовывал контактов с участием Lys217 и Met73 при наличии несубстратных оснований 8-oxoAde или Gua. Таким образом, можно предположить, что для эффективного узнавания ферментом Fpg поврежденного пуринового основания необходимо взаимодействие атомов, входящих или входивших в состав имидазольного цикла пуринового основания, или заместителей при этом цикле с остатками Lys217 или Met73.

Механизмы и субстратная специфичность некоторых ДНК-гликозилаз Мутационный анализ субстратной специфичности фермента Fpg Сайт-направленный мутагенез в сочетании с ферментативной кинетикой использовали для подтверждения роли отдельных взаимодействий в активном центре Fpg, выявленных при структурном анализе и компьютерном моделировании.

Основной интерес в этом случае представляло установление остатков, ответственных за субстратную специфичность фермента. В качестве отправной точки была исследована активность Fpg-WT по отношению к субстратам, содержащим 8-oxoGua (специфичный субстрат) или H2Ura (неспецифичный субстрат) и различные основания напротив поврежденного. Fpg эффективно выщеплял 8-oxoGua из пары 8oxoGua:Cyt, но был еще более активен на субстратах 8-oxoGua:Gua, 8-oxoGua:Thy и H2Ura:Cyt (Табл. 1).

Табл. 1. Параметры стационарной кинетики и связывания субстратов для разных форм Fpg kcat/KM, фермент субстрат kcat, мин–1 KM, нМ Kd, нМ нМ–1·мин–WT 8-oxoGua:Cyt 0,32±0,02 1,05±0,32 0,31 0,77±0,WT 8-oxoGua:Gua 0,21±0,01 0,10±0,03 2,1 3,7±1,WT 8-oxoGua:Thy 0,28±0,02 0,19±0,05 1,5 1,9±0,WT 8-oxoGua:Ade 0,066±0,004 22±5 0,003 26±R108A 8-oxoGua:Cyt 0,026±0,001 1,5±0,4 0,018 2,9±0,R108A 8-oxoGua:Gua 0,023±0,001 5,1±0,6 0,005 0,58±0,R108A 8-oxoGua:Thy 0,018±0,001 4,2±0,7 0,004 1,5±0,R108A 8-oxoGua:Ade 0,0045±0,0003 23±5 0,0002 61±K217T 8-oxoGua:Cyt 0,24±0,02 4,1±1,5 0,058 1,8±0,H89A 8-oxoGua:Cyt 0,45±0,04 4,1±1,6 0,11 1,9±0,R109A 8-oxoGua:Cyt 0,35±0,02 230±40 0,002 1100±1H89A/R109A 8-oxoGua:Cyt 0,21±0,02 440±110 0,0005 2400±2WT H2Ura:Cyt 0,70±0,03 0,68±0,20 1,0 0,44±0,K217T H2Ura:Cyt 0,56±0,04 0,61±0,26 0,93 0,71±0,H89A H2Ura:Cyt 0,98±0,07 0,70±0,30 1,4 0,65±0,R109A H2Ura:Cyt 0,32±0,02 4,7±1,0 0,068 99±H89A/R109A H2Ura:Cyt 0,24±0,02 9,6±2,5 0,025 110±R108A H2Ura:Cyt 0,32±0,01 0,70±0,12 0,46 1,3±0,Приведены среднее значение и стандартная ошибка коэффициента регрессии (n = 4–6) Для анализа возможной роли остатков His89, Arg108 и Lys217 фермента Fpg сравнивали кинетические параметры мутантных форм белка H89A, R109A и K217T (Табл. 1). Особый интерес представлял вопрос о том, могут ли какие-либо из замен селективно влиять на эффективность выщепления 8-oxoGua или H2Ura. Замена K217T оказывала заметное влияние на узнавание субстрата 8-oxoGua:Cyt в основном из-за повышения значения KM, а способность расщеплять H2Ura-содержащий субстрат практически не изменялась. Замена H89A также снижала активность Fpg по отношению к 8-oxoGua:Cyt за счет повышения KM. При введении замены R109A в седловой мотив Fpg активность фермента по отношению к 8-oxoGua:Cyt резко падала;

влияние замены R109A на выщепление H2Ura было менее выраженным. Еще большее снижение активности вызывала двойная замена H89A/R109A в седловом мотиве (Табл. 1). Существование замен, снижающих активность Fpg по отношению к 8oxoGua, но не к H2Ura, свидетельствует о том, что механизмы узнавания этих поврежденных оснований различны.

Для проверки роли остатка Arg108 в узнавании основания напротив поврежденного был исследована мутантная форма Fpg-R108A (Табл. 1). В результате замены активность Fpg по отношению к субстратам 8-oxoGua:Cyt и 8-oxoGua:Ade снижалась в 15–17 раз, к 8-oxoGua:Gua и 8-oxoGua:Thy — в 360–410 раз, а к H2Ura:Cyt — всего в 2 раза.

Различия при узнавании 8-oxoGua и H2Ura можно объяснить, если предположить, что седловой мотив действует в качестве «головки считывания» — структурного мотива, который способен образовывать связи с поврежденным основанием внутри ДНК или вносить конформационное напряжение в ДНК, которое приводит к локальным структурным изменениям только при наличии поврежденного звена.

Можно предположить, что остатки седлового мотива деформируют ДНК при поиске таким образом, чтобы обеспечить специфичное выворачивание 8-oxoGua в активный центр фермента, а частично дестабилизирующее ДНК основание H2Ura может легко выворачиваться без участия седлового мотива. После выворачивания поврежденное основание узнается в активном центре остатками Lys217 или Met73.

Термодинамические параметры связывания белка Fpg с поврежденной ДНК Механизмы превращения энергии при переходе между системами «фермент + субстрат» и «фермент + продукт» могут играть решающее значение в определении пути каталитической реакции и субстратной специфичности ферментов. Для исследования взаимодействия Fpg с поврежденной ДНК разного рода был использован метод изотермальной микрокалориметрии. Для ограничения исследования процессом связывания, не осложненным каталитическими превращениями, в качестве лигандов использовали дцОДН, содержащие нерасщепляемый карбоциклический аналог 8-oxodGua (8-oxocdGua) как модель субстрата, нерасщепляемый аналог AP-сайта (THF) как модель промежуточного продукта и однонуклеотидную брешь как модель конечного продукта.

Для качественной оценки эффективности связывания Fpg с разными лигандами применяли метод протеазного футпринтинга эндопротеиназой Glu-C.

Предварительная инкубация Fpg с THF- или cAP-лигандом приводила к снижению эффективности протеолиза, в то время как другие лиганды не защищали белок.

Типичная кривая связывания THF-лиганда, определенная методом изотермальной микрокалориметрии, показана на рис. 14. Из этих данных можно вычислить значения константы ассоциации Ka (1,95107 М–1), соответствующей ей изменение стандартной свободной энергии Гиббса G° = –9,3 ккал/моль) и его энтальпийный и энтропийный компоненты (H° = 14,2 ккал/моль, TS° = 23,5 ккал/моль). В отличие от THF-лиганда, титрование белком Fpg других лигандов сопровождалось незначительным поглощением теплоты. Форма изотермы связывания свидетельствовала о резком снижении эффективности взаимодействия с такими ОДН и согласуется с результатами футпринтинга. По-видимому, начальные этапы связывания ДНК белком Fpg обусловлены электростатическими взаимодействиями, которые экранируются в условиях высокой ионной силы.

Рис. 14. Изотерма связывания Fpg и лиганда THF:dCyd при 5°C, определенная методом изотермальной микрокалориметрии. A — общая теплота, поглощаемая при инъекции порций Fpg в ячейку, содержащую THF-лиганд. Б — изотерма связывания (—), рассчитанная по значениям H, полученным при интеграции площади пиков, соответствующих каждой инъекции ( ).

Определение термодинамических параметров связывания THF-лиганда белком Fpg при различных температурах показало, что оно представляет собой энтропийный процесс, а энтальпийный компонент не благоприятствует связыванию до ~25°C.

Подобная картина характерна для ассоциации макромолекул, сопровождающейся значительным десольватированием взаимодействующих поверхностей. Свободная энергия связывания практически не зависела от температуры, однако при этом наблюдались взаимно компенсирующие изменения энтальпийного и энтропийного компонентов. Связывание Fpg с THF-лигандом сопровождается снижением удельной теплоемкости, которая может быть рассчитана из зависимости H° от T (Cp = – 0,67 ккал/(К·моль)). Известно эмпирическое соотношение Сполара–Рекорда для оценки изменения удельной теплоемкости при связывании макромолекул:

Cp = [(0,32 ± 0,04)ANP – (0,14 ± 0,04)AP] кал/(К·моль), где ANP и AP — изменение площади (в 2) доступных растворителю неполярных и полярных остатков соответственно. Расчет для комплекса Fpg с ДНК дает значение Cp = – 0,25 ккал/(К·моль), что заметно отличается от значения Cp, определенного экспериментально. Такая картина часто наблюдается при связывании белков с ДНКлигандами, сопровождающемся перестройками белка или ДНК, что свидетельствует о конформационных изменениях, имеющих место при связывании Fpg с поврежденной ДНК.

Мутационный анализ субстратной специфичности фермента Nei Для определения ролей ключевых аминокислотных остатков Nei, выявленных методами РСА и компьютерного моделирования, были получены и охарактеризованы мутантные формы фермента Nei-E2A, Nei-E2Q, Nei-K52A, Nei-R212A и Nei-R252A.

Формы Nei-E2A, Nei-E2Q, Nei-K52A и Nei-R252A были неспособны расщеплять ДНК, содержащую основание H2Ura, но эффективно расщепляли субстрат, содержащий APсайты. Сохранение AP-лиазной активности при этих заменах указывает на то, что сеть связей, координирующая примыкающие к поврежденному dN фосфатные группы, нужна в основном для выщепления основания, для которого необходимо более точное позиционирование остатка Pro1 и C1’. Активность Nei-R212A по отношению к H2Uraсубстрату была лишь немного снижена, однако эффект этой замены проявлялся значительно сильнее, если субстрат содержал основание 5S,6R-Thy(OH)2, которое по данным компьютерного моделирования образует три водородных связи с Arg212.

Кроме того, методом сайт-направленного мутагенеза были исследованы другие функциональные элементы белка Nei — интеркалирующая петля QLY71, а также высококонсервативный среди белков Nei остаток Arg171 и абсолютно консервативный в семействе Fpg/Nei остаток Gln261, принимающие участие в ориентации цинкового пальца. Для оценки влияния замен определяли параметры стационарной кинетики расщепления субстратов, содержащих основания H2Ura, (5S,6R)-Thy(OH)2, (5R,6S)-Thy(OH)2, 8-oxoGua или AP-сайтов (Табл. 2).

Табл. 2. Параметры расщепления различных субстратов разными формами фермента Nei WT QLY/AAA R171A Q261A QLY H2Ura:Ade 0,22 0,11 не расщ.* не расщ. 0,0H2Ura:Cyt 74 5,7 не расщ. не расщ. 0,0H2Ura:Gua 510 0,093 0,054 не расщ. 0,H2Ura:Thy 54 4,4 не расщ. не расщ. 0,00(5S,6R)-Thy(OH)2:Ade 88 5,9 3,7 2,610–3 0,(5S,6R)-Thy(OH)2:Cyt 150 5,6 3,7 1,710–3 0,(5S,6R)-Thy(OH)2:Gua 1500 5,4 3,7 2,110–3 1,(5S,6R)-Thy(OH)2:Thy 150 5,4 3,7 3,010–3 0,(5R,6S)-Thy(OH)2:Ade 660 4,7 2,3 5,110–3 0,(5R,6S)-Thy(OH)2:Cyt 570 5,5 2,9 2,810–3 0,(5R,6S)-Thy(OH)2:Gua 870 20 3,1 4,410–3 1,(5R,6S)-Thy(OH)2:Thy 660 6,8 2,8 5,310–3 0,8-oxoGua:Ade 0,78 4,610–3 не расщ. 3,710–3 2,010–8-oxoGua:Cyt 1,4 6,610–3 не расщ. 1,110–3 4,310–8-oxoGua:Gua 1,4 5,810–3 не расщ. 1,710–3 3,810–8-oxoGua:Thy 1,1 5,510–3 не расщ. 2,910–3 1,410–AP:Ade 7700 3,2 не расщ. 1,010–3 не расщ.

AP:Gua 4800 5,0 не расщ. 6,010–4 не расщ.

Приведено среднее значение kcat/KM * Расщепления субстрата не наблюдается Замена остатков QLY-петли остатками Ala приводила к снижению активности по отношению практически ко всем субстратам на 2–4 порядка. Делеция QLY-петли приводила к полной потере активности фермента для большинством субстратов, а остаточная активность по отношению к Thy(OH)2-субстратам была очень низкой. В обоих случаях заметно снижалась специфичность фермента по отношению к основанию напротив поврежденного. Замены в районе цинкового пальца также приводили к заметному снижению активности фермента. В отличие от замен остатков Glu2, Lys52 и Arg252, замены в области QLY-петли и цинкового пальца инактивировали и AP-лиазную функцию Nei.

Nei-WT и Nei-Q261A эффективно сшивались с субстратами под действием NaBH4, хотя активность Nei-Q261A в условиях стационарной кинетики была крайне низкой. Накопление продукта в случае Nei-Q261A проходило с фазой всплеска, после чего практически останавливалось, что указывает на малую скорость высвобождения продукта. Ковалентный комплекс Nei-Q261A•ДНК накапливался в ходе реакции, что указывает на то, что Nei-Q261A не катализирует -элиминацию после образования основания Шиффа.

Специфичность узнавания субстратов ферментом OGGВ предыдущих разделах работы исследовались механизмы узнавания поврежденных оснований ферментом Fpg. Очень сходной с Fpg субстратной специфичностью обладает эукариотический фермент OGG1, который, однако, принадлежит к другому структурному суперсемейству ДНК-гликозилаз. В связи с этим был исследован механизм узнавания поврежденных оснований ферментом OGG1.

Для установления роли различных позиций 8-oxodGua в его узнавании ферментом OGG1, исследовали связывание и превращение дцОДН, содержащих основания 8-oxoGua, O6-метил-8-оксогуанин (6-OMe-8-oxoGua), 8-оксогипоксантин (8-oxoHyp), 8-oxoAde, 8-аминогуанин (8-NH2-Gua), 8-оксопурин (8-oxoPu), 8метоксигуанин (8-MeO-Gua), или звено 8-oxocdGuo (Табл. 3). Утрата поврежденным основанием только 2-аминогруппы или в комбинации с 6-кетогруппой, замена 6кетогруппы амино- или метоксигруппой и замена 8-кетогруппы метоксигруппой не приводили к снижению сродства, а в некоторых случаях и повышали его, однако утрата 8-кетогруппы или ее замена аминогруппой значительно ухудшали связывание с ферментом. Таким образом, природа заместителя при C8 критически важна для связывания фермента с поврежденной ДНК.

Табл. 3. Параметры связывания и расщепления различных субстратов ферментом OGGсубстрат или ДНК-гликозилазная реакция AP-лиазная реакция Kd, нМ kcat103, ksp103, kcat103, ksp103, лиганд KM, нМ KM, нМ мин–1 нМ–1·мин–1 мин–1 нМ–1·мин–8-oxoGua:Cyt 52±7 43±15 92±10 15 13±4 19±1 1,Gua:Cyt 690±150 не расщ.* 8-oxoHyp:Cyt 6,8±1,3 20±5 520±30 26 110±10 110±10 0,8-oxoPu:Cyt 9,3±2,2 1400±200 29±2 0,020 1300±300 4,7±0,3 0,008-MeO-Gua:Cyt 21±3 не расщ.

6-OMe-8-oxoGua:Cyt 0,53±0,18 8,0±2,4 1500±100 190 42±14 36±6 0,8-oxoAde:Thy 210±40 не расщ.

8-oxoAde:Cyt 0,80±0,08 16±4 1000±100 66 29±8 30±4 1,8-oxocdGuo:dCyd 35±6 не расщ.

8-NH2-Gua:Cyt 440±210 100±30 26±2 0,26 740±130 17±1 0,0Приведены среднее значение и стандартная ошибка коэффициента регрессии (n = 3–4).

* Расщепления субстрата не наблюдалось.

Природа заместителей при пуриновом ядре влияла на кинетические параметры реакции гораздо сильнее, чем на связывание. Утрата поврежденным основанием 2аминогруппы практически не оказывала влияния на эффективность основания как субстрата, но дополнительная утрата 6-кетогруппы давала очень плохой субстрат.

Утрата 8-кетогруппы или ее замена приводила к резкому снижению активности фермента. С другой стороны, модификация 6-кетогруппы значительно повышала выщепление ферментом таких оснований в паре с Cyt. Пуриновые основания, которые служат хорошими лигандами, но плохими субстратами для OGG1, могут использоваться для выявления заместителей, важных для катализа. Например, 8oxoPu (хороший лиганд и плохой субстрат) отличается от 8-oxoHyp (хорошего лиганда и хорошего субстрата) отсутствием 6-кетогруппы и протона при атоме N1.

Протон при N1 также отсутствует у 8-oxoAde и 6-OMe-8-oxoGua, которые проявляют хорошие субстратные свойства. Таким образом, наличие заместителя при C6 важно для катализа, а протонированная форма N1 — нет. 8-MeO-Gua и 8-NH2-Gua отличаются от 8-oxoGua, хорошего субстрата и лиганда, природой заместителя при Cи характером атома N7. Это позволяет предположить, что водородная связь N7[8oxoGua]–O[Gly42], обнаруживаемая в структуре фермента, необходима для катализа, но не вносит вклада в первичное узнавание.

Влияние ионов Me2+ на активность фермента OGGВ определенной методом РСА структуре OGG1 (Bruner et al. Nature 403:859, 2000) на поверхности контакта фермента с ДНК присутствует ион Ca2+. Исходя из этого, было исследовано влияние CaCl2, CdCl2, CoCl2, MgCl2, MnCl2, NiCl2 и ZnCl2 на способность фермента катализировать ДНК-гликозилазную и AP-лиазную реакции.

Из них CdCl2 и ZnCl2 ингибировали обе реакции. Если фермент инкубировали в присутствии CdCl2 или ZnCl2, а затем хелатировали ионы металлов EDTA, его активность в режиме стационарной кинетики не восстанавливалась (рис. 15А).

Кинетика инактивации при каждой концентрации Cd2+ описывалась уравнением первого порядка (рис. 15Б) с константой скорости инактивации k = 0,30 ± 0,05 мМ-1·мин-1.

Рис. 15. Необратимая инактивация фермента OGG1 CdCl2 и ZnCl2. А — радиоавтограф геля после электрофоретического разделения продуктов реакции (50 нМ субстрат, 2 нМ OGG1): 1 — EDTA и Me2+ отсутствуют, 2 — 5 мМ EDTA, 3 — 2 мМ ZnCl2, 4 — 1 мМ CdCl2, 5 — 2 мМ ZnCl2, затем 5 мМ EDTA, — 1 мМ CdCl2, затем 5 мМ EDTA. S — субстрат, P — продукт. Б — зависимость остаточной активности OGG1 от времени инкубации с CdCl2. Фермент инкубировали в отсутствие ( ) или в присутствии CdCl2 ( ), затем хелатировали ионы Cd2+ EDTA и измеряли гликозилазную активность.

Присутствие CdCl2 в реакционной смеси вызывало значительное снижение сродства OGG1 к поврежденной ДНК, однако оно восстанавливалось после хелатирования. В режиме кинетики одного оборота наличие CdCl2 приводило к полному ингибированию реакции, но хелатирование ионов Cd2+ также восстанавливало расщепление до нормального уровня. Однако Cd2+ заметно ингибировал образование ковалентного комплекса OGG1•ДНК как до, так и после хелатирования. Таким образом, можно выделить два механизма действия ионов Cd2+ на фермент OGG1: необратимая инактивация фермента и связывание комплекса OGG1-ДНК с бесконкурентным ингибированием.

Nei PEGPEIRRAADNLEAAIKG--------------KPLTDVWFAFPQLKPY-----QSQ Fpg PELPEVETSRRGIEPHLVG--------------ATILHAVVRNGRLRWPVSEEIYRL NEIL1 PEGPELHLASHFVNETCKG--------------LVFGGCVEKSS--VSRNPEVPFES NEIL2 PEGPSVRKFHHLVSPFVGQKVVKTGGSSKKLHPAAFQSLWLQDAQHGKKLFLRFDPD NEIL3 VEGPGCTLNGEKIRARVLPGQAVTGVRGTALQSLLGPAMSPAASLADVATSAAPMNA Nei LIGQHVTHVETRGKALLTHFSNDLT---------LYSHNQLYGVWRVVD-------- Fpg S-DQPVLSVQRRAKYLLLELPEG-W---------IIIHLGMSGSLRILP-------- NEIL1 SAYH--ISALARGKELRLTLSPLPGSQPPQKPLSLVFRFGMSGSFQLVP-------- NEIL2 EEMEPLNSSPQPIQGMWQKEAVDRELALGPS--AQEPSAGPSGSGEPVPSRSAETYN 1NEIL3 KDSGWKLLRLFNGYVYSGVETLGKELFMYFGPRALRIHFGMKGSILINP-------- 1Nei -TGEEPQTTRV---LRVKLQTADKTILLYSASDIEMLTPEQLTTHPF---------- 1Fpg -EELPPEKHDH-----VDLVMSNGKVLRYTDPRRFGAWLWTKELEGHNV-------- 1NEIL1 -AEALPRHAHL---RFYTAPPAPRLALCFVDIRRFGHWDPGGEWQPG---------- 1NEIL2 LGKIPSADAQRWLEVRFGLFGSIWVNDFSRAKKANKKGDWRDPVPRLVLHFSGGGFL 1NEIL3 -------REGE---NRGGASPALAVQLTRDLICFYDSSVELRNSVES---------- 1Nei LQRVG-P----DVLDPNLTPEVVKERLLSPRFR----NRQFAGLLLDQAFLAGLGNY 1Fpg LTHLG-P----EPLSDDFNGEYLHQKCAKKKTA-------IKPWLMDNKLVVGVGNI 1NEIL1 -R--G-P--CVLLEYERFRENVLRNLSDKAFDR------PICEALLDQRFFNGIGNY 1NEIL2 VFYNCQMSWSPPPVIEPTCDILSEKFHRGQALEALSQAQPVCYTLLDQRYFSGLGNI 2NEIL3 QQRVR-V----MEELDICSPKFSFSRAESEVKKQG--DRMLCDVLLDQRVLPGVGNI 1Nei LRVEILWQVGLTGNHKA-KDLNAAQLDALAHALLEIPRFSYATRGQVDENKHHGALF 2Fpg YASESLFAAGIHPDRLA-SSLSLAECELLARVIKAVLLRSIEQGGTTLKDFLQSDGK 2NEIL1 LRAEILYRLKIPPFEKARTVLEALQQCRPSPELTLSQKIKAKLQNPDLLELCHLVPK 2NEIL2 IKNEALYRARIHPLSLG-SCLSSSSREALVDHVVEFSKDWLRDKFQGKERH------ 2NEIL3 IKNEALFDSGLHPAVKVCQLSDKQACHLVKMTRDFSILFYRCCKAGSAISKH----- 2Nei R------FKVFHRDGEP------CERCGSIIEKTTLS----SRPFYWCPGCQH 2Fpg PGYFAQELQVYGRKGEP------CRVCGTPIVATKHA----QRATFYCRQCQK 2NEIL1 EVVQLG-GKGYGPERGEEDFAAFRAWLRCYGVPGMSSLR-DRHGRTIWFQGDPGPLA 2NEIL2 -----TQIYQKEQ----------CPSGHQVMKETFGPPDGLQRLTWWCPQCQPQLSS 3NEIL3 -----CKVYKRPN----------CDQCHSKITVCRFGEN--SRMTYFCPHCQKENPQ 2NEIL1 PKGGRSQKKKSQETQLGAEDRKEDLPLSSKSVSRMRRARKHPPKRIAQQSEGAGLQQ 3NEIL2 KGPQNLPSS 3NEIL3 CVQVCQLPTRNTEISWTPRGEDCFTDSVARKSEEQWSCVVCTLINRPSAKACDACLT 3NEIL1 NQETPTAPEKGKRRGQRASTGHRRRPKTIPDTRPREAGESSAS 3NEIL3 TRPLDSVLKNRENSIAFNNLVKYPCNNFENTHTEVKINRKTAFGNTTLVLTDLSNKS 3NEIL3 SALARKKRANHTIDGESQMFLPTDIGFSDSQHPSKEGINYITQPSNKVNISPTVCAQ 4NEIL3 SKLFSSAHKKFKPAHTSATELKSYNSGLSNSELQTNRTRGHHSKSDGSPLCKMHHRR 5NEIL3 CVLRVVRKDGENKGRQFYACSLPRGAQCGFFEWADLSFPFCRHGKRSIMKTVLKIGP 5NEIL3 NNGKNFFVCPLEKKKQCNFFQWAENGPGMEIVPGC 6Рис. 16. Выравнивание последовательностей белков Nei, Fpg, NEIL1, NEIL2 и NEIL3. Выделены функционально важные области белков семейства Fpg/Nei: N-концевой каталитический олигопептид (черные символы на сером фоне), мотив H2TH (белые символы на черном фоне) и цинковый палец (белые символы на сером фоне, отсутствует в mNEIL1). В последовательности NEIL3 выделены также второй цинковый палец (белые символы на сером фоне) и участок NEIL3, гомологичный повтору в C-концевой области топоизомеразы III (подчеркнут).

Белки NEIL млекопитающих и их возможная биологическая роль Окисленные азотистые основания в ДНК эукариот служат субстратами для ферментов суперсемейств Nth (OGG1, NTHL1) и урацил-ДНК-гликозилазы (SMUG1).

До сих пор не было известно ферментов животных, гомологичных белкам Fpg и Nei.

При поиске гомологов белка Nei в базах данных геномов человека и мыши были обнаружены три гена (neil1, neil2 и neil3; endonuclease eight-like). Их кДНК были клонированы и секвенированы, белки NEIL1 и NEIL2 были получены в рекомбинантном виде. На рис. 16 показано выравнивание последовательностей белков NEIL мыши и белков Nei и Fpg E. coli.

Фермент NEIL1 катализировал расщепление H2Ura-субстратов по механизму последовательной ,-элиминации и был способен сшиваться с субстратной ДНК под действием NaBH4. Фермент расщеплял субстраты, содержащие AP-сайты, Thy(OH)2, mFapy-Gua и H2Ura, со сравнимой эффективностью, 5-OH-Cyt и 5-OH-Ura выщеплялись хуже, а 8-oxoGua практически не узнавался (рис. 17А). Оба цисэнантиомера Thy(OH)2 эффективно выщеплялись ферментом (рис. 17Б). Напротив, фермент NTHL1 — основная ДНК-гликозилаза, ответственная за репарацию окисленных пиримидинов в клетках млекопитающих — выщеплял 5R,6S-Thy(OH)2 и практически не затрагивал 5S,6R-Thy(OH)2 (рис. 17Б).

Рис. 17. Субстратная специфичность NEIL1. А — сравнение кинетики расщепления NEIL1 дцОДН-субстратов, содержащих поврежденные звенья.

Б — кинетика выщепления различных стереоизомеров Thy(OH)2 напротив Ade ферментами NEIL1 и NTHL1.

Рис. 18. Зависимость выживаемости эмбриональных стволовых клеток мыши, трансформированных плазмидами pmH1P-neo (контроль) или pmH1Pmneil1 (3 независимо полученных линии), от дозы при -облучении.

Чтобы определить, необходим ли продукт гена neil1 для ответа на повреждения ДНК в клетках, использовали метод РНК-интерференции для получения линий эмбриональных стволовых клеток мыши, дефицитных по белку NEIL1. В линиях клеток, экспрессирующих короткую шпилечную РНК, соответствующую последовательности из экзона 1 гена neil1, уровень белка и мРНК был снижен до ~20% по сравнению с контролем. Чувствительность таких клеток к низким дозам излучения возрастала примерно в 2 раза (рис. 18).

Таким образом, в ходе данной работы открыты новые ДНК-гликозилазы млекопитающих, гомологичные бактериальным белкам Fpg и Nei. Субстратная специфичность одной из них, NEIL1, дает основания предположить, что она играет особую роль в предохранении клеток от повреждений ДНК, вызванных ионизирующим излучением. Сравнение последовательностей и структур гомологов Fpg и Nei из разных организмов позволяет выделить отдельное структурное суперсемейство ДНК-гликозилаз Fpg/Nei.

Взаимодействие ДНК-гликозилаз с кластерными повреждениями ДНК Кластерные повреждения ДНК образуются под действием ионизирующей радиации при повреждении звеньев, расположенных в пределах одного витка спирали, и представляют особую проблему для клетки, поскольку могут превращаться в двуцепочечные разрывы, в том числе и в ходе их репарации. Поэтому репарация отдельных повреждений в составе кластера должна тесно координироваться. Представлялось важным исследовать этот аспект субстратной специфичности известных ферментов, участвующих в репарации окисленной ДНК эукариот, в том числе открытого в ходе данной работы фермента NEIL1.

В клетках млекопитающих репарация окисленных пиримидинов осуществляется ДНК-гликозилазами NTHL1 и NEIL1. Для того, чтобы установить их роль в репарации окислительных повреждений ДНК, расположенных вблизи ОЦР, был разработан ряд ОДН-субстратов, содержащих звенья 5-OH-Ura или 8-oxoGua в положениях поблизости от ОЦР. Ни NTHL1, ни NEIL1 не выщепляли основание 5OH-Ura, из положения 2 с 5’-стороны от ОЦР (рис. 19). При смещении поврежденного звена в 5’-направлении активность NTHL1 по отношению к таким субстратам была минимальной, однако активность NEIL1 была сравнима с активностью этого фермента по отношению к субстрату без разрывов.

Рис. 19. Радиоавтограф геля после электрофоретического разделения продуктов реакции расщепления ферментами NTHL1 и NEILдцОДН-субстратов по звену 5-OHUra, расположенному поблизости от ОЦР. ОДН-субстраты (0,3 пмоль), указанные в верхней части рисунка, инкубировали с NTHL1 (0,6 пмоль) или NEIL(0,5 пмоль).

Ни NEIL1, ни OGG1 не выщепляли основание 8-oxoGua, из положения 2 с 5’стороны от ОЦР. При смещении поврежденного звена на 1 позицию в 5’-направлении активность OGG1 оставалась низкой, однако NEIL1 эффективно катализировал реакцию выщепления 8-oxoGua. Дальнейшее увеличение расстояния между поврежденным звеном и ОЦР вело к повышению активности OGG1 и снижению активности NEIL1. Таким образом, NEIL1 обладает уникальной способностью выщеплять поврежденные основания, расположенные с 5’-стороны от ОЦР, что может служить дополнительным объяснением чувствительности клеток, дефицитных по NEIL1, к -облучению. По всей вероятности, различия в активности NEIL1 с одной стороны и NTHL1 и OGG1 с другой стороны по отношению к ОЦР-содержащим субстратам объясняются тем, что фосфатная группа p–3 не образует важных контактов с ДНК-гликозилазами суперсемейства Fpg/Nei, но образует водородную связь с мотивом HhH в белках суперсемейства Nth, к которым относятся NTHL1 и OGG1.

Помимо ОЦР, в состав кластерных повреждений часто входят AP-сайты. Было изучено расщепление Fpg и OGG1 ряда субстратов, содержащих одновременно звенья 8-oxoGua и THF. В случае субстратов, в которых два модифицированных звена находились в соседних положениях, активность Fpg была очень низкой: например, введение THF с 3’-стороны от 8-oxoGua привело к уменьшению KM в 26 раз, а kcat в раз. В то же время значения кинетических параметров для расщепления субстратов, в которых поврежденные звенья были разделены 1 или 2 нормальными dN, слабо (в 1,5–2 раза) отличались от значений для 8-oxoGua-субстрата. Сходная картина наблюдалась и для OGG1, хотя этот фермент был в меньшей степени чувствителен к модификации звена в соседнем с 8-oxoGua положении. Возможно, это отражает разницу во взаимодействиях ДНК-связывающих центров Fpg и OGG1 с основаниями, соседними с поврежденным.

Конформационная динамика ДНК-гликозилаз Из описанных выше структурных данных и результатов сайт-направленного мутагенеза следует, что связывание Fpg и Nei с субстратом в одну стадию очень маловероятно. Для оценки динамики конформации ферментов Fpg и Nei при узнавании ими субстратных ДНК был использован метод «остановленной струи» с детекцией флуоресценции.

Конформационная динамика белка Fpg Исследовании изменений флуоресценции Trp показало, что за образованием первичного комплекса Fpg с 8-oxoGua-субстратом следует серия конформационных переходов, завершающаяся расщеплением субстрата. Для их соотнесения с конформационными изменениями, которые можно ожидать из структуры комплекса Fpg·ДНК, была разработана серия дцОДН-лигандов и субстратов усложняющейся структуры, содержащих в одной и той же позиции звенья Gua, THF, AP или 8-oxoGua.

Кинетические кривые флуоресценции для связывания нерасщепляемого THF-лиганда представлены на рис. 20А. Для определения минимального числа стадий в кинетической схеме проводили расчет констант скорости отдельных стадий по всему набору данных для схем с числом обратимых стадий от 1 до 10 и строили зависимость стандартного отклонения по всем точкам кривой от числа стадий. Равномерное уменьшение стандартного отклонения прекращалось после нескольких шагов, число которых дает число стадий в минимальной кинетической схеме. Такой анализ показал, что процесс связывания Fpg с THF-лигандом включает не менее 4 обратимых стадий (Схема 1).

При переходе от THF-лиганда к расщепляемому AP-субстрату наблюдался дополнительный участок в конце реакции (рис. 20Б, Схема 2).

А Б В Рис. 20. Кинетические кривые флуоресценции остатков Trp для нерасщепляемого THF-лиганда (А), APсубстрата (Б) и 8-oxoGua-субстрата (В).

k1THF,Trp k2THF,Trp k3THF,Trp k4THF,Trp E + L EL1THF,Trp EL2THF,Trp EL3THF,Trp EL4THF,Trp THF,Trp THF,Trp THF,Trp THF,Trp k–k–k–k–Схема 1. Связывание Fpg с THF-лигандом. E — фермент, L — THF-лиганд, ELiTHF,Trp — различные комплексы фермент–лиганд.

k1AP,Trp k2AP,Trp k3AP,Trp k4AP,Trp k5AP,Trp KPTrp E + S ES1AP,Trp ES2AP,Trp ES3AP,Trp ES4AP,Trp (EPgap E + Pmix) AP,Trp AP,Trp AP,Trp AP,Trp k–k–k–k–Схема 2. Связывание и превращение ферментом Fpg AP-субстрата. Pgap — продукт реакции (дцОДН с однонуклеотидной брешью), Pmix — продукт Pgap, диссоциировавший на 3 отдельных оцОДН; Kp — комбинированная константа диссоциации для процессов высвобождения продукта Pgap и его диссоциации в Pmix.

Общая форма кривых для AP-субстрата и THF-лиганда была идентична, за исключением последнего участка. Следовательно, в случае AP-субстрата обратимые стадии 1–4 соответствуют этим же стадиям для THF-лиганда и отражают конформационные превращения при узнавании поврежденного звена, а необратимая стадия, описываемая константой k5, связана с химическими процессами в ходе катализа. Поскольку использованный ОДН достаточно короток (12 п.н.), последняя стадия реакции включает как высвобождение продукта с однонуклеотидной брешью (Pgap), так и его диссоциацию на отдельные оцОДН (смесь Pmix).

При переходе к содержащему основание 8-oxoGua-субстрату (рис. 20В) реакция описывалась кинетической схемой, содержащей 5 обратимых стадий, предшествующих необратимой стадии (Схема 3).

k1OG,Trp k2OG,Trp k5OG,Trp k6OG,Trp KPTrp E + S ES1OG,Trp (...) ES5OG,Trp (EPgap E + Pmix) OG,Trp OG,Trp OG,Trp k–k– k–Схема 3. Связывание и превращение ферментом Fpg 8-oxoGua-субстрата.

Обратимые стадии отражают взаимную подгонку структур Fpg и ДНК-субстрата до каталитически компетентной конформации. Следовательно, узнавание субстрата ферментом Fpg представляет собой многостадийный процесс. Значения констант скорости, полученные для всех дцОДН, сведены в Табл. 4.

Для того, чтобы исследовать динамику конформационных изменений молекулы ДНК и соотнести их с динамикой белка, в использованные субстраты и лиганды было введено основание 2-аминопурина (aPu) либо с 5’-, либо с 3’-стороны от поврежденного звена. Флуоресценция aPu гасится при образовании стэкингвзаимодействий в ДНК или переходе в гидрофобное окружение. Оценка влияния звена aPu на кинетику реакции показала, что изменение флуоресценции Trp попрежнему описывалась схемой с 5 предкаталитическими стадиями, а константы скорости были близки полученным для 8-oxoGua-субстрата. Для неповрежденного Gua-лиганда наблюдалось небольшое увеличение флуоресценции aPu на временах < 10 мс, что может отражать дестабилизацию ДНК при связывании с ферментом. В случае THF-лиганда такого разгорания не наблюдалось, поскольку из-за отсутствия основания рядом с aPu его флуоресценция изначально не погашена; в дальнейшем наблюдалось затухание флуоресценции. Для AP-субстрата начальные фазы изменений флуоресценции совпадали с наблюдавшимися для THF-лиганда, а затем происходило ее разгорание. В случае 8-oxoGua-субстратов интенсивность флуоресценции aPu увеличивалась на временах < 10 мс, падала в интервале 0,1–10 с, а затем вновь возрастала. Для описания конформационных изменений всех ДНК-субстратов при взаимодействии с Fpg оказалось достаточно кинетической схемы, включающей предкаталитических обратимых стадии (Схема 4, Табл. 5).

Табл. 4. Константы скорости и константы равновесия отдельных стадий взаимодействия фермента Fpg с различными ОДН по данным флуоресценции остатков Trp G-лиганд* THF-лиганд AP-субстрат 8-oxoGua-субстрат k1, М–1·с–1 2,3108 1,5108 8,0108 3,21k–, с–1 2,7103 270 250 8k2, с–1 6,0 36 2k–, с–1 0,020 65 2,k3, с–1 10 10 6,k–, с–1 0,60 40 k4, с–1 0,040 11 9,k–, с–1 0,010 1,0 2,k5, с–1 0,20 0,k–, с–1 0,0k6, с–1 0,0KP, мкМ 1,8 2,* По Fedorova et al. Biochemistry 41:1520 (2002).

Для соотнесения друг с другом различных фермент-субстратных комплексов, обнаруживаемых при регистрации флуоресценции остатков Trp и aPu было проведено моделирование полной кинетической схемы реакции с использованием определенных констант скорости отдельных стадий. Оказалось, что комплекс ES1aPu соответствует комплексам ES2OG,Trp и ES3OG,Trp, а комплекс ES2aPu — комплексам ES4OG,Trp и ES5OG,Trp.

Анализ соответствия изменений флуоресценции конформационным переходам в фермент-субстратном комплексе проще всего начать с THF-лиганда. Четыре фазы, наблюдаемые на кривых флуоресценции Trp в этом случае соответствуют предкаталитическим стадиям реакции вплоть до выворачивания поврежденного dN.

Комплекс (E-THF)1Trp, скорее всего, соответствует неспецифично связанным с ДНК молекулам Fpg, а (E-THF)2Trp — комплексу первичного узнавания THF. Образование предкаталитических комплексов (E-THF)3Trp и (E-THF)4Trp может представлять собой стадии выворачивания звена THF и внедрение остатков белка внутрь спирали ДНК.

При связывании с ферментом AP-субстрата на кривых флуоресценции Trp и aPu наблюдается дополнительная, необратимая стадия. Неизвестно, в какой мере образование основания Шиффа, -элиминация, -элиминация и гидролиз основания Шиффа влияют на конформацию фермента и почему им всем соответствует только одна различимая по флуоресценции Trp стадия; вполне вероятно, что каталитические стадии после этапа взаимной подгонки конформации Fpg и ДНК не требуют значительных конформационных изменений, а в основном протекают за счет переходов протонов и электронов в активном центре. Наконец, если субстрат содержал звено 8-oxoGua, на кинетических кривых флуоресценции Trp наблюдалась дополнительная фаза, предшествующая каталитическим стадиям. Очевидно, выворачивание 8-oxoGua требует более масштабной подгонки конформации фермента по сравнению с выворачиванием AP-сайта. Сопоставление кинетических кривых флуоресценции Trp и aPu позволяет достаточно однозначно приписать отдельные изменения флуоресценции конформационным переходам в фермент-субстратном комплексе. Учитывая зависимость флуоресценции aPu от полярности его окружения, ее изменение может быть вызвано дестабилизацией стэкинг-взаимодействий, выворачиванием поврежденного dN и внедрением остатков белка в межцепочечную полость. Характерные времена накопления и расходования различных ES-комплексов указывают на то, что образование комплекса ES2OG,Trp соответствует стадии дестабилизации стэкинга ДНК за счет ее излома, начальных стадий интеркаляции или выворачивания и т.п. Следующая стадия, различимая по флуоресценции aPu, совпадает по времени с образованием комплекса ES4OG,Trp который соответствует либо выворачиванию поврежденного dN, либо внедрению интеркалирующих остатков в межцепочечную полость. Поскольку эта стадия сопряжена с уменьшением флуоресценции aPu, логично предположить, что она связана с интеркаляцией остатков фермента, частично восстанавливающей неполярное окружение aPu. Тогда образование комплекса ES3OG,Trp соответствует выворачиванию 8-oxoGua.

Таким образом, можно предложить следующую последовательность конформационных переходов при узнавании ферментом Fpg повреждений в ДНК.

Стадия 1 представляет собой образование первичного неспецифичного комплекса ES1Trp, в котором фермент связывает ДНК, но еще не вносит в нее значительных конформационных изменений. На стадии 2 происходит первичное узнавание поврежденного звена, сопровождающееся дестабилизацией ДНК (комплекс ES2Trp).

Стадия 3 соответствует выворачиванию поврежденного dN в активный центр фермента (ES3Trp), а стадия 4 — внедрению интеркалирующих остатков фермента в межцепочечную полость (ES4Trp). Стадия 5, наблюдаемая только в случае 8-oxoGuaсубстрата, соответствует изомеризации активного центра фермента (ES5OG,Trp).

k1aPu k2aPu k3aPu KPaPu E + S ES1aPu ES2aPu (EPgap E + Pmix) aPu aPu k–k–Схема 4. Связывание и превращение ферментом Fpg ДНК-субстратов по данным флуоресценции aPu.

Табл. 5. Константы скорости и константы равновесия отдельных стадий взаимодействия Fpg с субстратами aPu–8-oxoGua и 8-oxoGua–aPu по данным флуоресценции оснований aPu 8-oxoGua–aPu-субстрат aPu–8-oxoGua-субстрат k1, М–1·с–1 3,5108 6,91k–, с–1 900 8k2, с–1 250 7k–, с–1 12 k3, с–1 3,6 3,k–, с–1 39 k4, с–1 14 k–, с–1 1,2 3,k5, с–1 0,13 0,k–, с–1 0,0040 0,00k6, с–1 0,034 0,0KP, М 2,310–6 3,410–Kbind, М–1 2,9108 2,21Поскольку остаток Phe110 располагается на поверхности взаимодействия белка с ДНК для более детального анализа ранних конформационных изменений в ходе реакции были изучены мутантные формы белка Fpg-F110W и Fpg-F110A.

Минимальные схемы реакции для Fpg-F110W оставались теми же, что и для Fpg-WT, за исключением Gua-лиганда, связывание которого с Fpg-WT описывалось схемой с одной обратимой стадией, соответствующей первичному связыванию, а в случае FpgF110W можно было выделить еще две различимых по флуоресценции стадии, которые, скорее всего, отражают конформационные изменения, не наблюдаемые в Fpg-WT из-за отсутствия флуоресцентного остатка в подходящем месте поверхности взаимодействия белка с ДНК. Это свидетельствует о достаточно глубоком продвижении Gua по координате реакции. Замена Phe110 на остаток Ala, неспособный к интеркаляции, приводила к потере способности расщеплять 8-oxoGuaсубстраты, но активность по отношению к AP-субстратам сохранялась.

Взаимодействие Fpg-F110A с 8-oxoGua-субстратом можно было описать двумя стадиями, после чего реакция далее не проходила. Следовательно, Fpg-F110A образует нормальный первичный комплекс с 8-oxoGua-субстратом, но из-за невозможности интеркаляции боковой группы Phe реакция далее не протекает.

Конформационная динамика белка Nei Для того, чтобы установить, насколько многостадийный процесс узнавания характерен для ДНК-гликозилаз семейства Fpg/Nei, было проведено исследование взаимодействия с ДНК-лигандами и субстратами белка Eco-Nei в режиме остановленной струи. При этом использовался тот же набор субстратов и лигандов, что и для Fpg, однако вместо 8-oxoGua субстрат содержал H2Ura, а напротив поврежденного звена находилось основание Gua.

Обратимое связывание Nei с G-лигандом, в отличие от белка Fpg, описывалось двухстадийной схемой. При введении aPu в неповрежденный ОДН изменений его флуоресценции не наблюдалось, что свидетельствует об отсутствии значительного искажения конформации неспецифичной ДНК при связывании Nei. Связывание THFлиганда также описывалось двухстадийной схемой, однако константа скорости k–уменьшалась примерно на порядок, что отражает повышенное сродство Nei к поврежденной ДНК. Расщепление AP- и H2Ura-субстратов по данным флуоресценции Trp включало три обратимых предкаталитических стадии, необратимую стадию и обратимую стадию диссоциации комплекса фермент–продукт. Существование дополнительной обратимой стадии при взаимодействии Nei с AP-субстратом по сравнению с THF-лигандом свидетельствует о том, что после выворачивания поврежденного звена и заполнения межцепочечной полости происходит подгонка конформации фермента, необходимая для катализа. Как и в случае фермента Fpg, все химические этапы реакции сливались в одну различимую по флуоресценции необратимую стадию. Таким образом, в обоих случаях процесс узнавания поврежденной ДНК включает в себя несколько конформационных изменений, в ходе каждого из которых в принципе может осуществляться отбор правильного субстрата.

Динамические аспекты внутриклеточной локализации ферментов репарации Релокализация белка OGG1 в клетках в условиях окислительного стресса На сегодня остаются малоизученными внутриклеточная локализация ДНКгликозилаз и ее регуляция. Для более подробного исследования этих аспектов динамики ДНК-гликозилаз был выбран фермент OGG1.

Рис. 21. Иммунофлуоресцентная локализация OGG1 и 8-oxoGua в клетках HeLa, культивируемых в нормальных условиях и в условиях голодания. Приведены эпифлуоресцентные микрофотографии. А, Б — клетки, выращенные на полной среде. В, Г — клетки после 8 ч в условиях голодания. Д, Е — клетки после 8 ч в условиях голодания и последующих 16 ч на полной среде. А, В, Д — окраска клеток антителами к OGG1 и вторичными антителами, конъюгированными с Alexa 488. Б, Г, Е — окраска клеток антителами к 8oxoGua и вторичными антителами, конъюгированными с Alexa 568.

Были получены поликлональные и моноклональные антитела к OGG1, которые использовали для изучения локализации OGG1 в мышиных фибробластах и клетках HeLa in situ методами иммунофлуоресцентной микроскопии. Цитоплазматическое окрашивание концентрировалось в околоядерной зоне цитоплазмы, а в периферической цитоплазме было менее интенсивно и локализовалось в филаментозных структурах, распределенных по всей клетке. Ядра окрашивались несколько слабее, окрашивание носило диффузный характер, a области ядрышка не окрашивались. При индукции окислительного стресса кратковременным голоданием клеток наблюдалось возрастание интенсивности ядерного сигнала по сравнению с клетками, растущими на полной среде (рис. 21А, В). В клетках, подвергнутых 8часовому голоданию с последующим периодом восстановления, сигнал уменьшался (рис. 21В, Д), но все равно оставался выше, чем в контрольных клетках.

Окрашивание клеток HeLa или мышиных эмбриональных фибробластов антителами к 8-oxoGua выявило повышение уровня этого поврежденного основания в ядрах после 8-часового голодания (рис. 21Б, Г). Период восстановления после 8часового голодания приводил к возрастанию сигнала по сравнению с клетками, растущими на полной среде или голодающими клетками без периода восстановления.

Ассоциация цитоплазматической фракции белка OGG1 с микротрубочками Нельзя исключить, что в процесс релокализации OGG1 вовлечена какая-либо форма активного транспорта белка. В том случае, если эндогенный белок OGG1 имеет сродство к каким-то структурным компонентам клетки, следует ожидать, что их можно будет выявить, используя флуоресцентно меченый OGG1 как реагент для окрашивания.

Рис. 22. Окрашивание фибробластов NIH3T3 конъюгатом OGG1 с техасским красным. А, В — фазовоконтрастные микрофотографии. Б, Г — эпифлуоресцентные микрофотографии. Стрелками отмечены периферические складки мембраны.

Белок OGG1 конъюгировали с техасским красным и использовали вместо антител в иммунофлуоресцентной микроскопии (рис. 22). Была отчетливо видна обширная сеть филаментов, заполняющая большую часть клеточной цитоплазмы (рис. 22Б, Г).

Для установления природы филаментов, окрашиваемых TR-OGG1, проводили двойное окрашивание клеток конъюгатами TR-OGG1 и одним из трех реагентов, специфичных к цитоскелетным структурам разной природы: фаллоидином, антителами к десмину или антителами к -тубулину. Картина окраски антителами к -тубулину практически полностью совпадала с окраской TR-OGG1, а окраска клеток TR-OGG1 не наблюдалась при предварительной инкубации конъюгата с тубулином. В митотических клетках TR-OGG1 связывался с микротрубочками в составе веретена деления (рис. 23).

Рис. 23. Окрашивание митотического веретена конъюгатом TR-OGG(эпифлуоресцентные микрофотографии). А, Б, Г — клетки в метафазе, В — клетка в анафазе. Стрелками обозначены митотические хромосомы в метафазной пластинке (А) и астральные микротрубочки, исходящие из центросом (Г).

In vitro тубулин связывался с сефарозой, модифицированной белком OGG1.

Существование комплексов OGG1-тубулин также подтверждали методом лиганднаправленного фотолиза. При инкубации тубулина с конъюгатом OGG1 с фотосенсибилизатором бенгальским розовым (RB-OGG1) при освещении светом видимого спектра наблюдалось заметное селективное снижение расщепления тубулина. При обработке клеток RB-OGG1 или конъюгатом RB с антителами к OGGс облучением видимым светом наблюдалась деградация микротрубочек (рис. 24).

Рис. 24. Фотолиз микротрубочек in situ конъюгатом RB-OGG(эпифлуоресцентные микрофотографии). Фибробласты NIH3T3 инкубировали с немодифицированным белком OGG1 (А, Б) или с конъюгатом RBOGG1 (В, Г) и облучали светом видимого спектра. А, В — визуализация микротрубочек при помощи конъюгата OGG1 с Alexa 568. Б, Г — визуализация микротрубочек при помощи антител к -тубулину.

Данные результаты свидетельствует о том, что часть цитоплазматической фракции белка OGG1 на всем протяжении клеточного цикла существует в виде, ассоциированном с сетью микротрубочек.

Ассоциация цитоплазматической фракции белков NEIL2 и POL с микротрубочками Для исследования вопроса, связываются ли другие белки ЭРО с микротрубочками, или это характерно только для OGG1, использовали иммунофлуоресцентное окрашивание клеток антителами к ряду белков репарации и флуоресцентно мечеными белками репарации по тем же методикам, что применялась для OGG1. Положительные результаты были достигнуты с ДНК-полимеразой (POL) и ДНК-гликозилазой NEIL2.

Особенности ядерной и цитоплазматической локализации POL и NEILповторяли картину, наблюдаемую для OGG1. В интерфазных клетках флуоресцентно меченые белки POL и NEIL2 также окрашивали сеть микротрубочек, а в митотических — веретено деления и центросомы. Связывание POL и NEIL2 с компонентами микротрубочек in vitro изучали методом соосаждения с микротрубочками, стабилизированными паклитакселом (рис. 25А, Б). POL, NEIL2 и OGG1, использованный в качестве контроля, соосаждались с полимеризованными микротрубочками.

В Рис. 25. Фотография окрашенного кумасси голубым геля после электрофоретического разделения OGG1 (дорожки 1 и 2), POL (дорожки 3 и 4) и NEIL2 (дорожки 5 и 6), инкубированных с микротрубочками, стабилизированными паклитакселом, в отсутствие (А) и в присутствии (Б) лизатов, обогащенных MAP-белками. Дорожки 1, 3 и 5 (обозначены буквой P) содержат осадок после центрифугирования, дорожки 2, 4 и 6 (обозначены буквой S) — супернатант. Стрелками отмечена подвижность белков - и -тубулина (верхняя стрелка), OGG1, POL и NEIL2 (нижняя стрелка, молекулярная масса всех трех белков ~39 кДа). В — фотография окрашенного кумасси голубым геля после электрофоретического разделения продуктов лиганд-направленного фотолиза тубулина конъюгатами RB-OGG1 (дорожки 1 и 2), RB-POL (дорожки 3 и 4), и RB-mNEIL2 (дорожки 5 и 6) in vitro. Микротрубочки инкубировали с конъюгатами в темноте (дорожки 1, 3, 5) или при освещении светом видимого спектра (дорожки 2, 4, 6). Стрелкой отмечена подвижность - и -тубулина.

Cуществование специфичных комплексов POL и NEIL2 с тубулином подтверждали методом лиганд-направленного фотолиза тубулина in vitro (рис. 25В) и микротрубочек in situ конъюгатами RB-POL и RB-NEIL2 с результатами, сходными с наблюдаемым для OGG1. Таким образом, способностью связываться с микротрубочками обладает не только белок OGG1, но и два других фермента ЭРО — ДНК-полимераза и ДНК-гликозилаза NEIL2.

ЗАКЛЮЧЕНИЕ Настоящая работа представляет собой первое систематическое исследование, в результате которого был разработан комплексный подход к анализу активности и субстратной специфичности ферментов репарации, в целом применимый к любым ферментам. Подход объединяет исследования ферментов методом РСА, компьютерное моделирование и сравнение физико-химических свойств аминокислотных остатков в группах белковых последовательностей для формирования представлений о возможных функциях отдельных аминокислотных остатков в данных белках, а также сайт-направленный мутагенез, изучение термодинамики и кинетики взаимодействия ферментов с субстратами разной степени специфичности в стационарном и предстационарном режиме для экспериментальной проверки этих предположений. Использование такого комплексного подхода позволило изучить функционирование нескольких ДНК-гликозилаз бактериальной и эукариотической природы на уровнях от субмолекулярного до клеточного.

Методы структурного анализа высокого разрешения в настоящее время активно применяются не просто для установления структур белков, но и для исследования механизмов их функционирования, для чего необходимо определение структур белка в разном функциональном состоянии (например, комплекса фермента с разными типами субстратов, продуктов и ингибиторов), а также установление структур близко родственных белков. В настоящей работе была впервые определена структура белка Nei как в свободном виде, так и в комплексе с ДНК, структура белка Fpg в комплексе с ДНК и структура белка DenV в ковалентном комплексе с ДНК. Таким образом была закончена структурная характеризация всех главных семейств ДНК-гликозилаз.

Наиболее подробно была охарактеризована структура белка Nei, что позволило выявить конформационные изменения, происходящие при связывании им ДНК, и пластичность его активного центра, частично компенсирующую замены критических аминокислотных остатков. В целом структуры Fpg и Nei дают пример нового типа укладки ДНК-связывающих белков, в котором главная роль в связывании ДНК принадлежит немногочисленным гибким петлям, фиксированным на более жестких элементах структуры, которые разнесены по двум доменам белка и могут собираться вместе при связывании субстратной ДНК. Это делает укладки Fpg и Nei потенциально полезными для инженерии ДНК-зависимых ферментов с новой субстратной специфичностью.

Комбинация структурных, вычислительных и биохимических методов позволила в настоящей работе предложить механизм узнавания поврежденных оснований ферментами Fpg и Nei, который, вполне вероятно, может функционировать также в других ДНК-гликозилазах и в других классах ферментов. Согласно этому механизму, узнавание поврежденного звена начинается с того, что фермент вносит искажение в конформацию ДНК; в структуре Fpg обнаружен «седловой мотив», который идеально подходит для этой роли. По-видимому, неповрежденная ДНК достаточно устойчива к такой деформации, а поврежденная менее стабильна и может изламываться в точке повреждения. Затем следуют несколько конформационных изменений ферментсубстратного комплекса, в ходе которых аминокислотные остатки фермента внедряются в ДНК, а поврежденное звено выворачивается в активный центр фермента. На каждой из этих стадий в принципе возможна дискриминация ферментом поврежденных и неповрежденных оснований с тем, чтобы максимально облегчить попадание в активный центр поврежденных оснований и максимально затруднить это для неповрежденных. Наконец, окончательное узнавание ферментом поврежденного основания в ДНК происходит при образовании в активном центре ряда контактов, причем, по-видимому, ДНК-гликозилазы с достаточно широкой субстратной специфичностью могут образовывать несколько разных наборов таких контактов, обеспечивающих эффективное выщепление разных оснований. Подобные многоступенчатые механизмы могут использоваться для предотвращения процессинга неправильных субстратов другими ферментами (например, сходные механизм селекции субстрата действуют у сериновых протеаз и ДНК-полимераз).

В ходе работы открыта новая группа эукариотических ферментов, гомологичных Fpg и Nei. Активности этих ферментов (NEIL1–NEIL3) могут расширять спектр субстратов, репарируемых в клетках млекопитающих по механизму эксцизионной репарации оснований (ЭРО). Например, фермент NEIL1 удаляет из ДНК некоторые стереоизомеры тимингликоля, которые не выщепляются другими ферментами репарации окисленных пиримидинов. Кроме того, он может принимать участие в репарации поврежденных оснований, соседствующих с разрывами в составе кластерных повреждений ДНК. Эти активности важны для снижения повреждающего действия ионизирующего излучения. Вполне вероятно, что и другие белки NEIL обладают уникальными свойствами.

Проведены исследования одной из важнейших ДНК-гликозилаз млекопитающих, 8-оксогуанин-ДНК-гликозилазы (OGG1). Помимо изучения механизмов узнавания ею субстратов, в том числе кластерных повреждений, в настоящей работе показано, что ее инактивация может вносить вклад в генотоксичное действие ионов Cd2+. Еще более важным оказалось то, что цитоплазматическая фракция OGG1 по крайней мере частично связана с микротрубочками и может быстро перемещаться в ядро при генотоксическом стрессе. Помимо OGG1, была показана ассоциация с микротрубочками ДНК-гликозилазы NEIL1 и ключевого фермента ЭРО — ДНКполимеразы . Возможно, что с участием микротрубочек может происходить динамическое перераспределение и быстрая мобилизация цитоплазматических резервов ферментов репарации.

В работе получены данные, не имеющие аналогий в мировой литературе.

Полученные результаты позволили сформулировать несколько новых многообещающих направлений исследований. В частности, как показали результаты опытов с ферментом Fpg, очень перспективно исследование структурной динамики ДНК-гликозилаз при направленном введении флуоресцентных меток в различные части фермента или субстрата. Весьма интересным является вопрос о влиянии разнообразных факторов — других ферментов ЭРО, встречающихся в природе полиморфизмов и т.п. — на субстратную специфичность ДНК-гликозилаз. Слабо исследован механизм поиска поврежденных звеньев ДНК-гликозилазами, и их взаимодействие с неповрежденной ДНК требует углубленного изучения. Наконец, практически не изучены взаимодействия ДНК-гликозилаз с компонентами клетки, не относящимися к системе ЭРО. Можно с уверенностью утверждать, что изучение различных аспектов функционирования ДНК-гликозилаз и в ближайшие годы будет чрезвычайно актуально.

ВЫВОДЫ 1. Проведены структурно-функциональные исследования эндонуклеазы VIII (Nei) из E. coli:

• Методом рентгеноструктурного анализа (РСА) определены пространственные структуры фермента дикого типа и его мутантных форм с заменами критически важных аминокислотных остатков Glu2 и Arg252 в свободном состоянии и в ковалентном комплексе с ДНК, имитирующем интермедиат реакции, катализируемой этой эндонуклеазой.

• Показано, что при связывании поврежденной ДНК некоторые консервативные мотивы фермента изменяют конформацию и подвижность, а отдельные домены белка изменяют пространственную ориентацию, что приводит к сборке активного центра фермента.

• Установлено, что аминокислотные остатки Lys52, Asn168 и Arg252 фиксируют остов ДНК в активном центре фермента, остатки Gln69, Leu70 и Tyrобеспечивают выворачивание поврежденного звена в активный центр, остатки Pro1 и Glu2 участвуют в нуклеофильной атаке и протонировании дезоксирибозного цикла в ходе катализа, остатки Arg173 и Gln2обеспечивают корректное позиционирование цинкового пальца, а остаток Arg212 образует связи с поврежденным основанием.

• Показано, что активный центр Nei обладает достаточной пластичностью для частичной компенсации структурных изменений, образующихся при замене критически важных аминокислотных остатков.

• Методом «остановленной струи» с регистрацией флуоресценции остатков триптофана установлено, что каталитический акт с участием Nei включает как минимум пять стадий, сопровождающихся конформационными изменениями фермента. Три из них обратимы и отражают связывание ДНК и взаимную подгонку структур фермента и ДНК до каталитически компетентной конформации, одна необратимая стадия соответствует образованию и разрыву ковалентных связей в ходе реакции, и последняя, обратимая стадия связана с высвобождением продукта реакции.

2. Проведены структурно-функциональные исследования формамидопиримидинДНК-гликозилазы (Fpg) из E. coli:

• Методом РСА определена пространственная структура фермента в ковалентном комплексе с ДНК, имитирующем интермедиат реакции.

• Методом молекулярной динамики проведено компьютерное моделирование взаимодействий неповрежденных и поврежденных азотистых оснований (гуанин, 8-оксогуанин, 8-оксоаденин, 4,6-диаминопиримидин-5-илформамид, 2,4-диамино-6-оксо-1,6-дигидропиримидин-5-илформамид) в активном центре фермента, определены взаимодействия, важные для субстратной специфичности фермента.

• Установлено, что аминокислотные остатки Lys56, Asn168 и Arg258 фиксируют остов ДНК в активном центре фермента, остатки Met73, Arg108 и Phe1обеспечивают выворачивание поврежденного звена в активный центр, остатки Pro1 и Glu2 участвуют в нуклеофильной атаке и протонировании дезоксирибозного цикла в ходе катализа, остатки His89, Arg108 и Arg1обеспечивают изгиб ДНК, а остаток Lys217 образует связи с поврежденным основанием.

• Показано, что связывание ферментом Fpg поврежденной ДНК при низких температурах определяется энтропийным компонентом и сопровождается значительной дегидратацией поверхности взаимодействия, а при приближении к физиологическим температурам возрастает вклад энтальпийного компонента.

• Методом «остановленной струи» с регистрацией флуоресценции остатков триптофана и 2-аминопуриновой метки в ДНК установлено, что каталитический акт с участием Fpg включает как минимум семь стадий, сопровождающихся конформационными изменениями фермента. Пять из них обратимы и отражают связывание ДНК и взаимную подгонку структур фермента и ДНК до каталитически компетентной конформации, одна необратимая стадия соответствует образованию и разрыву ковалентных связей в ходе реакции, и последняя, обратимая стадия связана с высвобождением продукта реакции. Сравнение структуры фермента и данных предстационарной кинетики с различными субстратами и мутантными формами фермента позволило отнести эти стадии к неспецифичному связыванию ДНК, внедрению в ДНК интеркалирующего остатка Phe110, выворачиванию поврежденного звена ДНК в активный центр фермента, внедрению в ДНК интеркалирующих остатков Met73 и Arg108 и изомеризации активного центра фермента.

3. Открыты ДНК-гликозилазы высших эукариот, гомологичные белкам Fpg и Nei — NEIL1, NEIL2, NEIL3. Определен механизм действия фермента NEIL1, показана его роль в предохранении клеток млекопитающих от повреждения ДНК, вызываемого ионизирующей радиацией. Проведен сравнительный анализ последовательностей и пространственных структур Fpg, Nei и их известных гомологов. По результатам анализа выделена группа Fpg/Nei как отдельное структурное суперсемейство ДНК-гликозилаз, отличное от известных суперсемейств эндонуклеазы III (Nth) и урацил-ДНК-гликозилазы, определены консервативные мотивы, ответственные за активность и субстратную специфичность этих ферментов.

4. Проведено исследование субстратной специфичности Fpg и Nei из E. coli, NEILи 8-оксогуанин-ДНК-гликозилазы млекопитающих (OGG1).

• Показано, что в узнавании и превращении различных субстратов одним и тем же ферментом могут участвовать разные структурные элементы.

• Выделен мотив «головки считывания», важный для непрямого узнавания поврежденных оснований ДНК ферментами Fpg и Nei по вносимой ими в структуру ДНК нестабильности.

• Установлены и объяснены в рамках определенных структур ДНК-ферментных комплексов закономерности взаимодействия ферментов Fpg, OGG1 и NEIL1 с субстратами, содержащими кластерные повреждения.

5. Методом РСА установлена пространственная структура принадлежащего к суперсемейству Nth фермента эндонуклеазы V бактериофага T4 в ковалентном комплексе с ДНК, имитирующем интермедиат реакции. На основании сравнения всех установленных структур ковалентных комплексов ДНК-гликозилаз и ДНК предложен механизм реакции -элиминации, катализируемой бифункциональными ДНК-гликозилазами суперсемейств Nth и Fpg/Nei.

6. Обнаружено ингибирование фермента OGG1 ионами Cd2+, которое может объяснять синергизм токсичности кадмия и окислительного стресса в клетках млекопитающих. Описано два пути ингибирования, один из которых связан с необратимой инактивацией фермента, а другой — с обратимым связыванием иона Cd2+ с ферментом или фермент-субстратным комплексом.

7. Установлено, что цитоплазматическая фракция фермента OGG1 при мягком окислительном стрессе, вызванном голоданием, перераспределяется и преимущественно накапливается в клеточном ядре. Показано, что цитоплазматическая фракция OGG1, ДНК-гликозилазы NEIL2 и ДНКполимеразы ассоциирована с микротрубочками.

Основные результаты диссертации изложены в следующих работах:

1. Zharkov D.O., Rosenquist T.A., Gerchman S.E., Grollman A.P. (2000) Substrate specificity and reaction mechanism of murine 8-oxoguanine-DNA glycosylase. J. Biol.

Chem., 275, p. 28607–28617.

2. Zharkov D.O., Golan G., Gilboa R., Fernandes A.S., Gerchman S.E., Kycia J.H., Rieger R.A., Grollman A.P., Shoham G. (2002) Structural analysis of an Escherichia coli endonuclease VIII covalent reaction intermediate. EMBO J., 21, p. 789–800.

3. Gilboa R., Zharkov D.O., Golan G., Fernandes A.S., Gerchman S.E., Matz E., Kycia J.H., Grollman A.P., Shoham G. (2002) Structure of formamidopyrimidine-DNA glycosylase covalently complexed to DNA. J. Biol. Chem., 277, p. 19811–19816.

4. Zharkov D.O., Rosenquist T.A. (2002) Inactivation of mammalian 8-oxoguanine-DNA glycosylase by cadmium(II): Implications for cadmium genotoxicity. DNA Repair, 1, p. 661–670.

5. Zharkov D.O., Grollman A.P. (2002) Combining structural and bioinformatics methods for the analysis of functionally important residues in DNA glycosylases. Free Radic.

Biol. Med., 32, p. 1254–1263.

6. Minetti C.A.S.A., Remeta D.P., Zharkov D.O., Plum G.E., Johnson F., Grollman A.P., Breslauer K.J. (2003) Energetics of lesion recognition by a DNA repair protein:

Thermodynamic characterization of formamidopyrimidine-glycosylase (Fpg) interactions with damaged DNA duplexes. J. Mol. Biol., 328, p. 1047–1060.

7. Rosenquist T.A., Zaika E., Fernandes A.S., Zharkov D.O., Miller H., Grollman A.P.

(2003) The novel DNA glycosylase, NEIL1, protects mammalian cells from radiationmediated cell death. DNA Repair, 2, p. 581–591.

8. Zharkov D.O., Shoham G., Grollman A.P. (2003) Structural characterization of the Fpg family of DNA glycosylases. DNA Repair, 2, p. 839–862.

9. Conlon K.A., Zharkov D.O., Berrios M. (2003) Immunofluorescent localization of the murine 8-oxoguanine DNA glycosylase (mOGG1) in cells growing under normal and nutrient deprivation conditions. DNA Repair, 2, p. 1337–1352.

10. Zharkov D.O., Ishchenko A.A., Douglas K.T., Nevinsky G.A. (2003) Recognition of damaged DNA by Escherichia coli Fpg protein: Insights from structural and kinetic data. Mutat. Res., 531, p. 141–156.

11. Zaika E.I., Perlow R.A., Matz E., Broyde S., Gilboa R., Grollman A.P., Zharkov D.O.

(2004) Substrate discrimination by formamidopyrimidine-DNA glycosylase: A mutational analysis. J. Biol. Chem., 279, p. 4849–4861.

12. Koval V.V., Kuznetsov N.A., Zharkov D.O., Ishchenko A.A., Douglas K.T., Nevinsky G.A., Fedorova O.S. (2004) Pre-steady-state kinetics shows differences in processing of various DNA lesions by Escherichia coli formamidopyrimidine-DNA glycosylase. Nucleic Acids Res., 32, p. 926–935.

13. Golan G., Zharkov D.O., Fernandes A.S., Zaika E., Kycia J.H., Wawrzak Z., Grollman A.P., Shoham G. (2004) Crystallization and preliminary crystallographic analysis of endonuclease VIII in its uncomplexed form. Acta Crystallogr., D60, p. 1476–1480.

14. Conlon K.A., Zharkov D.O., Berrios M. (2004) Cell cycle regulation of the murine 8oxoguanine DNA glycosylase (mOGG1): mOGG1 associates with microtubules during interphase and mitosis. DNA Repair, 3, p. 1601–1615.

15. Perlow-Poehnelt R.A., Zharkov D.O., Grollman A.P., Broyde S. (2004) Substrate discrimination by formamidopyrimidine-DNA glycosylase: Distinguishing interactions within the active site. Biochemistry, 43, p. 16092–16105.

16. Zharkov D.O. Predicting functional residues in DNA glycosylases by analysis of structure and conservation. In: Practical Bioinformatics, Bujnicki J.N., Ed. SpringerVerlag: 2004. P. 243–261.

17. Conlon K.A., Miller H., Rosenquist T.A., Zharkov D.O., Berrios M. (2005) The murine DNA glycosylase NEIL2 (mNEIL2) and human DNA polymerase bind microtubules in situ and in vitro. DNA Repair, 4, p. 419–431.

18. Parsons J.L., Zharkov D.O., Dianov G.L. (2005) NEIL1 excises 8-oxoguanine located near a DNA single strand break. Nucleic Acids Res., 33, p. 4849–4856.

19. Golan G., Zharkov D.O., Feinberg H., Fernandes A.S., Zaika E.I., Kycia J.H., Grollman A.P., Shoham G. (2005) Structure of the uncomplexed DNA repair enzyme endonuclease VIII indicates significant interdomain flexibility. Nucleic Acids Res., 33, p. 5006–5016.

20. Zharkov D.O., Grollman A.P. (2005) The DNA trackwalkers: Principles of lesion search and recognition by DNA glycosylases. Mutat. Res., 577, p. 24–54.

21. Golan G., Zharkov D.O., Grollman A.P., Dodson M.L., McCullough A.K., Lloyd R.S., Shoham G. (2006) Structure of T4 pyrimidine dimer glycosylase in a reduced imine covalent complex with abasic site-containing DNA. J. Mol. Biol., 362, p. 241–258.

22. Kropachev K.Y., Zharkov D.O., Grollman A.P. (2006) The catalytic mechanism of Escherichia coli endonuclease VIII: Roles of the intercalation loop and the zinc finger.

Biochemistry, 45, p. 12039–12049.

23. Кирпота О.О., Жарков Д.О., Бунева В.Н., Невинский Г.А. (2006) Взаимодействие 8-оксогуанин-ДНК-гликозилазы человека с одно- и двухцепочечными ДНК.

Молекуляр. биология, 40, с. 1055–1063.

24. Zharkov D.O., Golan G., Shoham G., Kropachev K.Y., Grollman A.P., Kuznetsov N.A., Koval V.V., Douglas K.T., Nevinsky G.A., Fedorova O.S. (2006).

Structural dynamics of Escherichia coli endonuclease VIII.//Сборник трудов международной конференции «Физико-химическая биология», посвященной 80летию академика Д.Г. Кнорре. — Новосибирск: АРТА. — С. 29-30.

25. Kuznetsov N.A., Koval V.V., Zharkov D.O., Nevinsky G.A., Douglas K.T., Fedorova O.S. (2007) Pre-steady-state kinetic study of substrate specificity of Escherichia coli formamidopyrimidine-DNA glycosylase. Biochemistry, 46, p. 424– 435.

26. Старостин К.В., Ищенко А.А., Жарков Д.О., Бунева В.Н., Невинский Г.А. (2007) Взаимодействие ферментов репарации про- и эукариот с олигодезоксирибонуклеотидами, содержащими кластерные повреждения.

Молекуляр. биология, 41, с. 112–120.

27. Kuznetsov N.A., Zharkov D.O., Fedorova O.S. (2007) Conformational dynamics of interactions of Escherichia coli endonuclease VIII with DNA substrates. J. Biomol.

Struct. Dyn., 24, p. 615-616.

28. Жарков Д.О. (2007) Структура и конформационная динамика гликозилаз эксцизионной репарации оснований ДНК. Молекуляр. биология, 41, с. 772–786.







© 2011 www.dissers.ru - «Бесплатная электронная библиотека»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.