WWW.DISSERS.RU

БЕСПЛАТНАЯ ЭЛЕКТРОННАЯ БИБЛИОТЕКА

   Добро пожаловать!


На правах рукописи

Ребриков Денис Владимирович

ПОЛИМОРФНЫЕ МОЛЕКУЛЯРНО-ГЕНЕТИЧЕСКИЕ МАРКЕРЫ И ОПРЕДЕЛЕНИЕ ИХ АЛЛЕЛЬНОГО СТАТУСА В СЛОЖНЫХ СМЕСЯХ МОЛЕКУЛ НУКЛЕИНОВЫХ КИСЛОТ Специальности

03.00.15 – генетика 03.00.03 – молекулярная биология

АВТОРЕФЕРАТ

диссертации на соискание ученой степени доктора биологических наук

Москва – 2008

Работа выполнена в Институте биоорганической химии им. М.М.Шемякина и Ю.А.Овчинникова РАН, Институте общей генетики им. Н.И.Вавилова РАН и ЗАО «НПФ ДНК-Технология» (г. Москва)

Научный консультант:

доктор биологических наук, профессор, чл.-корр. РАН Янковский Николай Казимирович

Официальные оппоненты:

доктор биологических наук, профессор Машко Сергей Владимирович, Государственный научно-исследовательский институт генетики и селекции промышленных микроорганизмов доктор биологических наук, профессор Даниленко Валерий Николаевич, Институт общей генетики им. Н.И.Вавилова РАН доктор биологических наук Патрушев Лев Иванович, Институт биоорганической химии им. М.М.Шемякина и Ю.А.Овчинникова РАН

Ведущая организация:

Московский Государственный Университет им. М.В.Ломоносова

Защита состоится 21 октября 2008 года в ______ часов на заседании диссертационного совета Д 002.214.01 при Институте общей генетики им. Н.И.Вавилова РАН по адресу:

119991 ГСП-1, Москва, ул. Губкина, д.3. Тел/факс: (499) 132-89-

С диссертацией можно ознакомиться в библиотеке Института общей генетики им. Н.И.Вавилова РАН

Автореферат разослан «____» сентября 2008 года

Ученый секретарь диссертационного совета Г.Н.Полухина

ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ

Актуальность темы. Одной из актуальных задач современной молекулярной биологии является сравнение двух близких по составу образцов нуклеиновых кислот (ДНК или РНК) из одного организма или разных организмов внутри одного вида с целью обнаружения различий между ними. Различия могут заключаться как в наличии (отсутствии) молекул нуклеиновых кислот с определенной последовательностью в одном из образцов, так и в количественных (концентрационных) вариациях последовательностей, присутствующих в обоих сравниваемых образцах.

Выявление индивидуальных или видоспецифичных генетических особенностей является комплексной технологической задачей, осложненной тем, что особенности эти могут составлять лишь малую часть генетического материала сравниваемых организмов (вплоть до одного нуклеотида). Поэтому подходы к выполнению такого рода исследований, чаще всего, базируются на методе полимеразной цепной реакции, позволяющем нарабатывать молекулы ДНК определенной последовательности начиная с минимальных количеств стартового материала.

Так, различия геномов близкородственных штаммов бактерий представляют большой интерес для исследователей, поскольку могут определять наличие у данного штамма уникальных черт (патогенности, повышенной вирулентности, устойчивости к антибиотикам и т.д.). Благодаря появлению полных последовательностей геномов близкородственных бактериальных штаммов стало возможным определение эффективности прямого сравнения бактериальных геномов методами вычитающей гибридизации.

Исследование полиморфных участков генома человека, ассоциированных с развитием заболеваний или определенными фенотипическими особенностями, требует создания высокопроизводительных и недорогих методов определения аллельного состояния этих регионов. Появление оборудования, позволяющего регистрировать накопление ДНК в ходе полимеразной цепной реакции, создало предпосылки для развития простых и высокопроизводительных методов генотипирования при помощи ПЦР.

Вместе с тем, появившаяся возможность снятия кинетики накопления продукта ПЦР в ходе реакции позволяет с высокой точностью оценивать количество определенных молекул ДНК в исследуемом образце. Это дало толчок к разработке подходов к измерению концентрации отдельных нуклеиновых кислот при помощи полимеразной цепной реакции с регистрацией результатов «в реальном времени».

В связи с вышеизложенным, особенно актуальным является создание новых методов определения генетических различий трех типов: 1) методов поиска последовательностей нуклеиновых кислот, присутствующих лишь в одном из сравниваемых образцов (дифференциально представленные последовательности), 2) высокопроизводительных методов детекции определенных генетических полиморфизмов и 3) методов количественного определения отдельных последовательностей ДНК или РНК при помощи полимеразной цепной реакции с регистрацией результатов «в реальном времени».

Цель работы. Целью данной работы являлось создание новых методов выявления уникальных и полиморфных последовательностей в сложных смесях молекул нуклеиновых кислот, а именно: 1) методов сравнения сложных образцов нуклеиновых кислот для поиска дифференциально представленных последовательностей, 2) методов детекции определенных генетических полиморфизмов и 3) методов количественного определения отдельных нуклеиновых кислот при помощи полимеразной цепной реакции «в реальном времени».

Задачи исследования. Для достижения поставленной цели необходимо было решить следующие задачи:

1. Исследовать возможности применения метода вычитающей гибридизации нуклеиновых кислот при а) поиске последовательностей, отличающих близкородственные бактериальные геномы и б) поиске транскриптов с различной представленностью в сравниваемых образцах.

2. Создать метод определения однонуклеотидных полиморфизмов с использованием нового фермента с уникальными свойствами – термостабильной дуплексспецифичной нуклеазы.

3. Усовершенствовать технологию детекции однонуклеотидных полиморфизмов на основе аллель-специфичной полимеразной цепной реакции с использованием ПЦР «в реальном времени» с флуоресцентно-мечеными олигонуклеотидными пробами или праймерами.

4. Разработать алгоритм проведения исследования и анализа результатов ПЦР «в реальном времени», повышающий точность и воспроизводимость количественного ПЦР-анализа в сравнении с существующими методами и оценить точность метода при проведении количественного исследования.

Научная новизна работы. Впервые определена полнота и эффективность метода гибридизационного сравнения геномов путем прямого сопоставления результатов shotgun секвенирования близкородственных прокариотических геномов (на 99%) и результатов их вычитающей гибридизации. На примере сравнения эукариотических транскриптомов продемонстрирована эффективность метода вычитающей гибридизации с использованием этапа зеркально-ориентированной селекции. Впервые обнаружен фермент с уникальными свойствами: термостабильная нуклеаза, неспецифичная к последовательности нуклеотидов, полностью расщепляющая двуцепочечные ДНК и ДНК цепь в ДНК/РНК гетеродуплексах, но не действующая на одноцепочечные молекулы ДНК. Клонирован ген фермента, определена его последовательность, охарактеризована субстратная специфичность и физико-химические свойства нуклеазы. На основе уникальных свойств фермента разработана новая схема определения однонуклеотидных полиморфизмов при помощи коротких флуоресцентномеченых гибридизационных проб. Усовершенствована технология детекции однонуклеотидных полиморфизмов на основе аллель-специфичной полимеразной цепной реакции с использованием ПЦР «в реальном времени» с флуоресцентно-мечеными олигонуклеотидными пробами или праймерами. Впервые продемонстрирована возможность эффективного различения аллелей при помощи нескольких флуоресцентно-меченых аллельспецифичных праймеров в одной пробирке. Создан принципиально новый алгоритм проведения исследования и анализа результатов ПЦР «в реальном времени», основанный на считывании уровня флуоресценции дважды в течение одного цикла реакции. Создана математическая модель обработки полученных результатов. Впервые установлена точность метода ПЦР «в реальном времени», как инструмента количественного исследования на примере определения процентного содержания генетически модифицированных ингредиентов в пищевых продуктах и кормах. Показано, что точность относительного количественного исследования для метода ПЦР «в реальном времени» составляет около 30% вне зависимости от марки используемого оборудования и наборов реагентов.

Практическая ценность работы. Проведено обследование различных групп населения, включая выборки по региону проживания и национальности (16 популяций), выборки с определенными видами заболеваний, группы по профессиональной принадлежности. Впервые проведено обследование 7 популяций россиян на полиморфизмы генов, ассоциированных с устойчивостью к ВИЧ и развитием СПИД. Для 4 российских популяций впервые определена частота генотипа по полиморфному маркеру C13910T, ассоциированному с первичной гиполактазией. С целью количественной оценки корреляций генотипа и фенотипа (венозный тромбоз) проведено обследование выборки пациентов ФГУ Российский Кардиологический Научно-Производственный Комплекс Росздрава по ряду полиморфизмов, ассоциированных с заболеваниями сердечно-сосудистой системы. Впервые исследовано распределение частот аллелей генов, ассоциированных с физической активностью на выборках профессиональных спортсменов в различных видах спорта, в результате чего обнаружены корреляции определенных генотипов и реакции организма на физические нагрузки разного профиля. Установлен уровень точности метода ПЦР как инструмента для количественного определения примеси генетически модифицированного материала в пищевых продуктах.

Реализация и внедрение результатов работы. На основе усовершенствованной методики вычитающей гибридизации нуклеиновых кислот разработаны и выпускаются наборы реагентов для сравнения сложных смесей ДНК и кДНК. Разработаны и внедрены в серийное производство (ЗАО «НПФ ДНК-Технология») тест-системы для определения диагностически значимых полиморфизмов в геноме человека методом аллель-специфичной полимеразной цепной реакции (АС-ПЦР) с использованием ПЦР «в реальном времени» (всего более 60 тест-систем, список разработанных тест-систем приведен в Приложении 1).

Алгоритм анализа результатов ПЦР «в реальном времени» реализован в составе программного обеспечения для трех моделей серийных отечественных детектирующих ДНКамплификаторов. Разработанные методики апробированы и применяются в Федеральном государственном учреждении «Лечебно-реабилитационный центр» Федерального агентства по здравоохранению и социальному развитию Росздрава, (г. Москва), Институте биоорганической химии им. М.М.Шемякина и Ю.А.Овчинникова РАН (г. Москва), Институте общей генетики РАН (г. Москва), Научном центре акушерства, гинекологии и перинатологии РАМН (г. Москва), Московском государственном университете им.

М.В.Ломоносова (г. Москва), Государственном учреждении научно-исследовательский институт питания РАМН (г. Москва), ряде областных и городских СЭС МЗСР РФ, широком спектре коммерческих диагностических лабораторий.

Основные положения, выносимые на защиту.

1. Установлена полнота и эффективность метода гибридизационного сравнения геномов путем прямого сопоставления результатов секвенирования близкородственных прокариотических геномов (на 99%) и результатов их вычитающей гибридизации.

Установлена эффективность метода гибридизационного сравнения эукариотических транскриптомов.

2. Предложен и реализован принципиально новый метод определения аллельного состояния полиморфных локусов, основанный на использовании термостабильной дуплекс-специфичной нуклеазы с уникальными свойствами.

3. Предложен и реализован новый алгоритм проведения исследования и анализа результатов ПЦР «в реальном времени», основанный на двойном считывании уровня флуоресценции при разных температурах в ходе одного цикла реакции, повышающий точность исследования в 3 раза в сравнении с традиционно применяемым подходом.

4. Предложена и реализована технология детекции однонуклеотидных полиморфизмов с использованием нескольких флуоресцентно-меченых аллель-специфичных праймеров в одной реакции за счет использования дополнительных кросс-мутаций, что повышает эффективность дифференцировки аллелей более чем в 2 раза.

5. Установлена точность метода ПЦР «в реальном времени» при проведении количественного исследования на примере определения процентного содержания генетически модифицированных ингредиентов (ГМИ) в пищевых продуктах и кормах.

Апробация работы. Основные результаты работы были представлены на более чем 20 отечественных и 6 международных конференциях, в том числе: съездах общества биотехнологов России им. Ю.А.Овчинникова (Москва, Россия, 2003-2005), симпозиуме «Молекулярная диагностика» II-й Международной конференции «Молекулярная медицина и биобезопасность» (Москва, Россия, 2005), международной конференции «Генетика в России и мире» (Москва, Россия, 2006), конференции Human Genome Meeting (Хельсинки, Финляндия, 2006), VI Съезде аллергологов и иммунологов СНГ (Москва, Россия, 2006), 21-й международной конференции Европейской Федерации Иммуногенетиков (Барселона, Испания, 2007), XI Всероссийском Форуме с международным участием имени академика В.И.Иоффе «Дни иммунологии в Санкт-Петербурге» (Санкт-Петербург, Россия, 2007), 6-ой ежегодной конференции «Цитокины и воспаление» (Орландо, США, 2008) и на многочисленных приглашенных научных семинарах в различных научно-исследовательских учреждениях в России и за рубежом.

Публикации. По теме диссертации опубликовано 28 печатных работ, включая методическое пособие издательства Колд Спринг Харбор и методическое пособие по анализу бактериальных патогенов серии «Научные книги НАТО». В том числе 18 работ в журналах, рекомендованных ВАК.

Личный вклад автора. Автору принадлежит решающая роль в разработке дизайна экспериментов, отработке методик и обобщении полученных результатов. Автор руководил работами по приложению созданных методик на практике. Личный вклад автора в данном исследовании составляет около 80%.

Структура и объем работы. Диссертация изложена на 150 страницах, содержит таблиц, 34 рисунка и состоит из введения, обзора литературы, описания объектов и методов исследования, результатов исследования и их обсуждения, выводов, списка литературы (включающего 125 источников) и трех приложений.

СОДЕРЖАНИЕ РАБОТЫ

1. Исследование возможностей метода вычитающей гибридизации нуклеиновых кислот.

1.1. Исследование возможностей метода вычитающей гибридизации нуклеиновых кислот при поиске последовательностей, отличающих близкородственные бактериальные геномы.

Выбор модели для характеристики метода вычитающей гибридизации нуклеиновых кислот. Сравнительный анализ бактериальных геномов показывает, что даже разные штаммы одного и того же вида бактерий могут существенно отличаться набором генов, присутствующих в геноме. Подобные штаммоспецифичные гены представляют большой интерес, поскольку могут определять характерные черты исследуемого штамма, такие как вирулентность или устойчивость к медикаментозным препаратам, а также, могут быть использованы в качестве маркеров в эпидемиологии и эволюционных исследованиях.

В связи с существенным удешевлением и огромной пропускной способностью современных методов определения нуклеотидных последовательностей исследователи все чаще применяют подход с биоинформационным сравнением полных последовательностей геномов для поиска штаммоспецифичных участков. Однако стоимость определения полного бактериального генома по прежнему остается достаточно высокой, а эффективное биоинформационное сравнение требует наличия достаточно полных последовательностей.

Данная часть работы была направлена на исследование возможностей метода вычитающей гибридизации нуклеиновых кислот при поиске последовательностей, отличающих близкородственные бактериальные геномы. В ходе исследования было установлено, что супрессионная вычитающая гибридизация (SSH) позволяет получать представительный набор фрагментов ДНК, отличающих два близкородственных штамма бактерий (свыше 90% от всех штаммоспецифичных локусов) при стоимости исследования на порядок ниже полногеномного секвенирования.

В качестве метода оценки эффективности вычитающей гибридизации нуклеиновых кислот было решено использовать результаты биоинформационного сравнения полных (на 99%) последовательностей геномов выбранных для вычитающей гибридизации микроорганизмов. Поскольку на момент начала работы в открытых базах данных нуклеотидных последовательностей не присутствовало ни одной пары достаточно полных последовательностей геномов близкородственных бактериальных штаммов, было решено провести определение полной нуклеотидной последовательности геномов двух штаммов золотистого стафилококка с их последующим сравнением методом вычитающей гибридизации.

Золотистый стафилококк (Staphylococcus aureus) является одной из основных внебольничных и госпитальных инфекций во всем мире. Он продуцирует целый спектр факторов патогенности, в частности токсинов, в состав которых входят суперантигены, вызывающие такие тяжелые последствия как синдром токсического шока и стафилококковая скарлатина. Вдобавок ко всему, этот патоген приобрел устойчивость практически ко всем антибиотикам, включая антибиотики последних поколений.

Для сравнения геномов были выбраны два близких штамма S. aureus (ZX и ZW).

Штамм ZW представляет собой метициллин-устойчивый штамм S aureus, полученный из коллекции штаммов медицинской школы Чикагского университета (США), а штамм S.

aureus ZX являлся стандартным референсным штаммом, полученным из Американской коллекции типов культур (номер в ATCC 29213). Бактериальные штаммы были дополнительно идентифицированы как S. aureus при помощи стандартных микробиологических методов.

В ходе эксперимента было решено провести поиск последовательностей, присутствующих в геноме метициллин-устойчивого штамма S. aureus ZW и отсутствующих в геноме референсного штамма ZX, методами биоинформационного и гибридизационного сравнения.

Биоинформационное сравнение геномов Staphylococcus aureus. Последовательности геномов обоих штаммов были определены при содействии компании Integrated Genomics Inc, (США) в рамках данного исследования. Определение нуклеотидной последовательности выполняли по методу Сенгера (с использованием автоматических секвенаторов ABI 377, Applied Biosystems, США) с применением стратегии определения случайных коротких фрагментов генома (shotgun genome sequencing) с пятикратным перекрыванием полной последовательности генома. После биоинформационного выравнивания коротких фрагментов было получено примерно 99% от полной последовательности генома каждого из штаммов).

Биоинформационное сравнение полученных последовательностей геномов проводили с использованием программ Sequencher (Gene Codes Corporation, США), DNASTAR 4.(DNASTAR Inc, США) и набора программ ERGOTM bioinformatics suite (http://www.integratedgenomics.com/genomic.html). Множественное выравнивание и сравнение с базами нуклеотидных последовательностей проводили с использованием алгоритма blastn со стандартными параметрами (http://www.ncbi.nlm.nih.gov/blast/). Поскольку метод вычитающей гибридизации способен приводить к существенному обогащению специфичных последовательностей только в том случае, если различия в последовательности нуклеотидов сравниваемых фрагментов ДНК составляют не менее 20-25%, для корректной характеристики метода SSH при проведении биоинформационного сравнения из рассмотрения были исключены штаммоспецифичные последовательности, обладающие сходством, превышающим 75% совпадающих нуклеотидов.

На основании биоинформационного сравнения последовательностей геномов штаммов ZW и ZX были обнаружены 79 локусов, содержащих ZW-специфичные регионы и удовлетворяющих приведенным выше критериям. Анализ последовательностей этих локусов показал, что большая часть ZW-специфичных регионов представляет собой следствие двух эволюционных событий: интеграции бактериофагов и переноса генов из родственных видов бактерий.

Сравнение геномов S. aureus методом супрессионной вычитающей гибридизации.

Для определения способности метода супрессионной вычитающей гибридизации находить штаммоспецифичные последовательности ДНК, было проведено гибридизационное сравнение геномов выбранных штаммов, причем ДНК генома S. aureus штамм ZW была выбрана в качестве трейсера, а геном штамма ZX был использован в качестве драйвера.

Таким образом, предполагалось найти регионы ДНК (локусы), присутствующие только в штамме ZW. Для проведения SSH нами была использована эндонуклеаза рестрикции Rsa I, сайт расщепления которой встречается в геноме в среднем один раз на 250 пар нуклеотидов.

Фрагменты ДНК, полученные в результате вычитающей гибридизации, были клонированы и процент дифференциальных клонов (клонов, специфичных только для штамма ZW) был определен с помощью дифференциального скрининга. Было установлено, что не менее 95% клонов в полученной библиотеке содержат последовательности, специфичные для тестируемого штамма, но не для референс-штамма (рис. 1).

проба с ДНК штамма ZW проба с ДНК штамма ZX Рис. 1. Результат дифференциального скрининга ZW-специфичной библиотеки. Клонированные продукты вычитающей гибридизации были амплифицированы с помощью ПЦР, нанесены на фильтры Hybond N+ и гибридизованы с радиоактивно-мечеными геномными ДНК каждого из штаммов.

Для анализа того, насколько полно полученная ZW-специфичная библиотека представляет штаммоспецифичные локусы, нами была определена последовательность нуклеотидов клонированных фрагментов ДНК для 289 случайно отобранных рекомбинантных клонов. Только 11 из 289 отобранных клонов содержали общие для двух штаммов фрагменты без каких либо отличий по последовательности ДНК, что составило менее 4% от общего числа клонов. Сравнение оставшихся 278 клонов между собой выявило 88 не перекрывающихся фрагментов, из которых:

1) 69 фрагментов представляли специфичные для тестируемого (ZW) генома последовательности.

2) 6 фрагментов содержали участки паралогичных генов, обладающих сходством по последовательности нуклеотидов на 50-60% (процент совпадающих нуклеотидов).

3) 8 фрагментов представляли собой клоны, содержащие фрагменты транспозонов, интегрировавших в разные участки геномов сравниваемых штаммов, и включающие место стыка последовательностей генома и транспозона.

4) 5 фрагментов представляли собой клоны, содержащие участки генома ZW, для которых один или оба ограничивающих фрагмент сайта Rsa I в результате точечных мутаций были утеряны для аналогичных участков генома штамма ZX (или наоборот, возникли в штамме ZW).

В дальнейшем будем называть молекулы, перечисленные в пунктах 1 – соответственно относящимися к первому – четвертому типам молекул, обнаруженных в результате сравнения бактериальных геномов методом SSH.

Использование эндонуклеаз рестрикции для получения набора фрагментов сравниваемых бактериальных геномов накладывает ряд ограничений на получаемые результаты. Известно, что чем протяженнее штаммоспецифичный участок генома и чем большее число сайтов узнавания для выбранной эндонуклеазы рестрикции он содержит, тем выше вероятность обнаружить данный локус в результирующей библиотеке. Метод SSH позволяет также обнаруживать фрагменты, только часть последовательности которых (но не менее 50-100 пар оснований) является специфичной для трейсера, а сама специфичная последовательность расположена на одном из флангов фрагмента. Подобные молекулы образуются, если один из сайтов для выбранной эндонуклеазы расположен внутри штаммоспецифичного локуса, а ближайший к нему сайт находится уже в общей для сравниваемых геномов части. Некоторое обогащение получают и молекулы, для которых штаммоспецифичные участки вообще отсутствуют, но при этом в драйверном геноме исчез сайт для эндонуклеазы, либо фрагмент генома трейсера состоит из последовательностей, находящихся в разных частях генома драйвера. О повышении содержания молекул подобного типа в результирующей библиотеке могут свидетельствовать 13 обнаруженных фрагментов, относящихся к упомянутым выше пунктам 3 и 4.

Строго говоря, последовательности, относящиеся к пунктам 3 и 4 не являются штаммоспецифичными, поскольку присутствуют в обоих сравниваемых геномах. Можно утверждать, что существует значительное давление вычитающей гибридизации на такие молекулы, а, следовательно, их обогащение невелико. На это указывает тот факт, что для молекул типов 3 и 4 лишь один из фрагментов (из пункта 4) был представлен двумя клонами.

Остальные фрагменты состояли из последовательностей, найденных в сделанной выборке в единственном экземпляре, в то время как фрагменты первого типа в подавляющем большинстве случаев были представлены двумя или более одинаковыми клонами (в среднем, клоны, составляющие фрагменты первого типа, повторялись в выборке три раза).

На рисунке 2 показана зависимость накопления специфичных для тестируемого штамма последовательностей от числа секвенированных клонов. По мере накопления последовательностей график выходит на плато, поскольку все чаще попадаются клоны, которые уже были определены. Из графика следует, что около 75% ZW-специфичных локусов были обнаружены после секвенирования 180 клонов, а после анализа 250 клонов были найдены порядка 95% от всех штаммоспецифичных локусов, учитывемых в исследовании. При этом нахождение локуса фиксировали, если хоть один из возможных Rsa I фрагментов данного локуса (в том числе и частично дифференциальный) был найден в библиотеке.

Из графика, а также из данных по количеству повторов каждого клона среди полученных последовательностей, можно сделать вывод о том, что дальнейшее увеличение выборки не приведет к существенному увеличению количества найденных дифференциальных локусов.

Часть локусов (в нашем случае около 5%) будет неизбежно потеряна из-за отсутствия в них сайтов для выбранной эндонуклеазы рестрикции. При этом процент таких потерь будет тем выше, чем Рис. 2. Процент уникальных локусов, идентифицированных в библиотеке клонов после реже сайт узнавания выбранной супрессионной вычитающей гибридизации в зависимости от числа клонов с установленной эндонуклеазы встречается в сравниваемых последовательностью клонированного фрагмента ДНК.

геномах.

Исследователям, предполагающим использовать SSH для поиска дифференциально представленных последовательностей, можно рекомендовать осуществлять выбор наиболее подходящей эндонуклеазы, исходя из GC состава ДНК данного вида бактерий (очевидно, что это должен быть частощепящий фермент). Кроме того, наиболее полную картину различий между геномами можно получить, выполнив несколько сравнений с использованием различных эндонуклеаз. Такой подход может значительно снизить потери, связанные со случайным расположением сайтов узнавания ферментов рестрикции.

10 локусов, предположительно ZW-специфичных по итогам биоинформационного сравнения последовательностей геномов двух штаммов, не были обнаружены в ZWспецифичной библиотеке, полученной после SSH. Для проверки истинной дифференциальности данных клонов мы выбрали 4 из 10 локусов и определили их присутствие в геномах сравниваемых штаммов с помощью Саузерн-блот гибридизации (рис. 3). Все 4 проанализированных фрагмента показали равную представленность в обоих штаммах и, таким образом, оказались ложноположительными при биоинформационном сравнении.

Полученные нами результаты наглядно демонстрируют, что метод SSH позволяет получать библиотеки клонов с равномерно представленными целевыми фрагментами, без явного превалирования одних последовательностей над другими. Но что еще более важно, определение последовательности лишь 250 клонов из библиотеки SSH дало столько же информации Рис. 3. Саузерн-блот анализ предполагаемых ZWоб уникальных последовательностях одно из специфичных локусов, не обнаруженных в библиотеке клонов после супрессионной штаммов, сколько и определение полных вычитающей гибридизации. Каждая дорожка на геле содержит 10 мкг обработанной Rsa I геномной последовательностей сравниваемых ДНК штаммов S. aureus ZX и ZW. Праймеры для получения проб были подобраны на основе бактериальных геномов. Таким образом, четырех ZW-специфичных последовательностей, обнаруженных при сравнении полных данное исследование показало, что последовательностей геномов этих штаммов супрессионная вычитающая гибридизация (клоны ZW2-B03, ZW2-H11, ZW3-F08 и ZW3-F10).

Продукты ПЦР были клонированы и плазмидные является одним из наиболее эффективных ДНК были помечены с помощью [32P]dATP. Все четыре протестированных локуса не показали путей для выявления представительного дифференциальной представленности в геномах сравниваемых штаммов. Последовательность клона набора локусов, отличающих геномы ZW2-H11 присутствует в геноме штамма ZW дважды.

близкородственных бактериальных штаммов.

1.2. Исследование возможностей метода вычитающей гибридизации нуклеиновых кислот в сочетании с методом зеркально-ориентированной селекции при поиске дифференциально представленных тракскриптов.

Для оценки эффективности использования метода вычиатющей гибридизации нуклеиновых кислот в сочетании с методом зеркально-ориентированной селекции было проведено сравнение трансктиптов из мышиных CD4+CD25+ клеток и CD25- клеток, изолированных из лимфоузлов 10-недельных мышей. Изолированные клетки перед выделением РНК были простимулированы анти-CD3 антителами в полной среде с добавлением интерлейкина 2 в течение 20 часов.

С полученными таким образом суммарными препаратами РНК CD4+CD25+ клеток и CD25- клеток при использовании метода супрессионной вычитающей гибридизации были сконструированы две библиотеки клонов (CD25+ и CD25-). Для создания библиотеки клонов CD25+, РНК из CD4+CD25+ клеток была использована как тестер, а РНК из CD25- клеток как драйвер. Таким образом библиотека клонов была обогащена транскриптами, в большей концентрации представленными к клетках CD4+CD25+ в сравнении с клетками CD25-. Для создания библиотеки клонов CD25- РНК из CD25- клеток была использована как тестер, а РНК из CD4+CD25+ клеток как драйвер, а результирующая библиотека клонов была обогащена транскриптами, в большей концентрации представленными к клетках CD25-.

Процент клонов, содержащих дифференциально представленные последовательности был определен при помощи дифференциального скрининга и Нозерн-блот анализа, показавшего, что полученные библиотеки клонов содержат около 2% истинно дифференциальных последовательностей.

С целью повышения процента дифференциальных клонов, к полученным после супрессионной вычитающей гибридизации продуктам ПЦР был применен метод зеркальноориентированной селекции, с получением новых CD25+ и CD25- специфичных библиотек клонов. Для определения процента дифференциальных клонов в каждой из библиотек, был проведен скрининг случайно отобранных клонов методом дот-блот гибридизации. На рисунке 4 показан результат дот-блот гибридизации полученных после применения зеркально-ориентированной селекции CD25+ и CD25- специфичных библиотек клонов.

Скрининг библиотек показал, что применение метода зеркально-ориентированной селекции в использованной модели повысило процент истинно дифференциальных клонов более чем в 10 раз. В таблице 1 приведен результат дифференциального скрининга 5клонов из CD25+ специфичной библиотеки и 96 клонов из CD25- специфичной библиотеки.

Рис. 4. Дот-блот анализ CD25+ (A) и CD25- (Б) специфичных библиотек. Из каждой из библиотек были отобраны по 96 клонов и клонированные участки были наработаны при помощи ПЦР. По 100 нг продуктов ПЦР было нанесено на нейлоновые мембраны с получением по 2 идентичных мембраны с каждого набора клонов.

Каждая из мембран гибридизована с [32P]dATP -мечеными CD25+ и CD25- специфичными пробами.

Подсчет общего числа дифференциально представленных клонов показал, что CD25+ библиотека после применения метода зеркально-ориентированной селекции содержит 20% дифференциально представленных клонов, а CD25- библиотека - 33% дифференциально представленных клонов. Различный уровень транскрипции некоторых из обнаруженных последовательностей был подтвержден при помощи Нозерн-блот гибридизации (рис. 5).

Таблица 1. Результат дифференциального скрининга CD25+ и CD25- специфичных библиотек клонов.

Число скринированных Число (%) позитивных Число уникальных Библиотека клонов клонов последовательностей CD25+ специфичная 520 107 (20%) CD25- специфичная 86 30 (35%) Таким образом, в данном эксперименте удалось показать, что применение дополнительного этапа зеркально-ориентированной селекции при сравнении сложных смесей молекул РНК может приводить к увеличению дифференциально представленных клонов в результирующей библиотеке более чем в 10 раз.

Рис. 5. Подтверждение предполагаемых дифференциально представленных клонов при помощи виртуального Нозерн-блот анализа. На каждую дорожку наносили по 0,5 мкг продукта амплифицированной кДНК соответствующей линии клеток и проводили гибридизацию с [32P]dATP-меченой ДНК клонов из CD25+ специфичной (A03+, A09+, G01+) и CD25- специфичной (B04-, G03-, H02-) библиотек.

2. Создание метода определения однонуклеотидных полиморфизмов с использованием термостабильной дуплекс-специфичной нуклеазы.

2.1. Клонирование и очистка новой нуклеазы камчатского краба.

Однонуклеотидный полиморфизм ДНК (ОНП, single nucleotide polymorphisms, SNP) представляет собой вариацию отдельных нуклеотидов в последовательности ДНК, для которой частота встречаемости в популяции наименее распространенного варианта превышает 1% (Kruglyak et al., 2001). ОНП – наиболее частая причина существования нескольких вариантов одного гена (аллелей), на их долю приходится подавляющее большинство вариаций в геноме человека (Taillon-Miller et al., 1999).

К настоящему времени из более чем 10 миллионов выявленных в геноме человека ОНП известно несколько тысяч полиморфизмов, связанных с индивидуальной предрасположенностью к заболеваниям, определенным биохимическим профилем, устойчивостью к воздействию окружающей среды (и, в частности, различных лекарственных препаратов) и т.д. Высокая плотность и эволюционная стабильность ОНП делают их одним из наиболее привлекательных генетических маркеров. Анализ ОНП широко применяется в популяционных исследованиях и при генетическом картировании (Cavalli-Sforza, 1998).

Все вышеперечисленное делает чрезвычайно актуальным развитие методов быстрого и недорогого определения аллельного состояния по широкому спектру ОНП для большого числа индивидуумов. Данная часть исследования была направлена на клонирование и изучение свойств уникальной нуклеазы из гепатопанкреаса камчатского краба и разработку метода определения однонуклеотидных полиморфизмов с использованием нового фермента.

Последовательность кДНК нуклеазы камчатского краба (Paralithodes camtschaticus) была получена с помощью модифицированной стратегии 3'-SMART RACE (Matz et al., 1999) с использованием вырожденных праймеров, соответствующих наиболее консервативному участку аминокислотной последовательности нуклеаз, полученной на основании выравнивания последовательностей неспецифичных нуклеаз различных видов организмов.

После клонирования 3'-фрагмента кДНК и определения его последовательности, с помощью той же технологии SMART RACE была получена 5'-концевая часть кДНК.

При сравнении с базами данных аминокислотных последовательностей, последовательность нуклеазы краба показала наибольшее сходство с нуклеазой креветки Penaeus japonicus (64% совпадающих аминокислот) (Chou et al., 1990; Wang et al., 2000).

Анализ аминокислотной последовательности с помощью алгоритма SMART (Schultz et al., 2000) показал наличие у фермента сигнального пептида длиной 27 остатков и неспецифичного ДНК/РНК-нуклеазного домена (NUC domain). Выравнивание NUC-домена краба с известными доменами беспозвоночных, грибов и бактериальных ферментов (рис. 6) показал наличие у фермента краба активного сайта, сходного с активным сайтом фермента креветки. (Wang et al., 2000). С использованием клонированного гена зрелый фермент краба был наработан в клетках E. coli. Несмотря на то, что рекомбинантный белок не был активен, он был использован для иммунизации кроликов с целью получения поликлональных антител. Активная нуклеаза камчатского краба была экстрагирована из гепатопанкреаса краба путем осаждения ацетоном с последующей хроматографией на колонках с DEAE Macro-Prep, Phenyl-Agarose, Hydroxyapatite, Heparin-Sepharose и Sephadex G75. Фракции после хроматографии тестировали на наличие ДНКазной активности и на связывание с ранее полученными поликлональными антителами. Очищенная нуклеаза краба при анализе методом денатурирующего электрофореза в полиакриламидном геле выявлялась как единственная полоса с массой около 42 kDa.

200 220 240 2crab_NUC : VSMSTVYSQASQ--LQLMTDILGDSDLANNIIDPSQQLY----FAKGHMSPDADFVTVAE--QDATYYFINALPQW Pj_NUC : VSMSTCYTQNSQ--LASMKILLGDDDLANAIINPHEQYY----FAKGHLAPDADFVTEAE--QDATYYYINAVPQW Dm_CG14120 : KDVNTLYTQVQQ--NITVSEILGMD--ASPYFNTTGNVY----LARGHLSAKTDFVFGAA--QKASFFFVNAAPQW NUC_Helico : SVLFGDLVDKNN---IEKRYEFKPDTRLAEYQQAVTQDYTRSGFDRGHFVANDASFDFASNPLRETYRMTNITPEA Ce_NUC85 : EHLTPERLKHAEG-VDRKLCEFKPDITFPQKFLSQNTDYKCSGFDRGHLAAAGNHRKSQL-AVDQTFYLSNMSPQV NUCG_HUMAN : EQLRPERLRGDG---DRRECDFREDDSVHAYHRATNADYRGSGFDRGHLAAAANHRWSQK-AMDDTFYLSKVAPQV NUC1_CUNEE : EHLTADSLKTGDG-VDRDHSKFKEDPDVPSLFRSTLADYSGSGFDRGHMAPAGDAVATQP-AMDQTFYLSNMSPQV NUC1_SYNRA : EHLTSASLQAGQG-VDRDKSNFQEDTDIPEMFRAHLKDYVSSGYDRGHQAPAADDLSSQE-AMDETFLLSNMAPQV NUCA_SERMA : YHITKDTPASGKTRNWKTDPALNPADTLAPADYTGAN--AALKVDRGHQAPLASLAGVSD--WESLNYLSNITPQK NUC_BORBU : TLLKSKKIKR--------STKFFEDTNIKGAFPKLEDYF-KSGYDRGHIVSSADMSFSEN-AMKDTYFLSNMSPQK *** ** 280 300 3crab_NUC : QA-FNNGNWKYLEYATRDLAE-SHGSDLRVYSGGWSLLQLDDINGN----PVDILLGLSEGKEVVPVPSLTWKVV Pj_NUC : QA-FNNGNWKYLEFATRDLAE-SHSTDLTIYTGGWGVLTLDDINGN----PVEIYLGLTEDEMVVPAPAITWKVV Dm_CG14120 : QT-FNGGNWERIEDSVRKFVA-DENITVDCYTGTWGVSTLPDVNGI---GRELYLDFDENNNGLIPVPKLYFRVI NUC_Helico : KN-TNRHSVLLVEKEGRNLAR--KYHQVLVEELTIIKQGYR-----------------TFSSKNIAIPSGFWYHY Ce_NUC85 : GRGFNRDKWNDLEMHCRRVAK--KMINSYIITGPLYLPKLE-GDGK------KYIKYQVIGDNNVAVPTHFFKVA NUCG_HUMAN : PH-LNQNAWNNLEKYSRSLTR--SYQNVYVCTGPLFLPRTE-ADGK------SYVKYQVIGKNHVAVPTHFFKVL NUC1_CUNEE : GIGFNRHYWAYLEGFCRSLTK--KFSDVYVFTGPLFLPTKG-SDGK-------YTVTYNVLQGNVAVPTHFYKVI NUC1_SYNRA : GVGFNRHYWAYLEGFMRDLTQ--NFTDVYVYTGPLFLPSAA-STGRKNPAYSIEYPFLGATTPNVPVPTHFFKIA NUCA_SERMA : SD-LNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMG---------------KLPGTQKAHTIPSAYWKVI NUC_BORBU : SE-FNSGIWLKLEKLVREWAI--SKGYIYIISAGILTENKG-----------------FIGKNKILIPKNFYKIV * * * * Рис. 6. Выравнивание аминокислотной последовательности NUC домена нуклеазы краба (crab_NUC) и NUC доменов нуклеаз креветок (Pj_NUC, AJ133437), белка CG14120 Drosophila (Dm_CG14120, AE003539), предполагаемой эндонуклеазы Helicobacter pylori (NUC_Helico, NC_000921), предполагаемого белка Caenorhabditis elegans C41D11.5 (Ce_NUC85, O01975), эндонуклеазы G человека (NUCG_HUMAN, NP_004426), нуклеазы C1 Cunninghamella echinulata (NUC1_CUNEE, AAC78769), SR-нуклеазы Syncephalastrum racemosum (NUC1_SYNRA, P81204), нуклеазы Serratia marcescens (NUCA_SERMA, P13717) и эндонуклеазы Borrelia burgdorferi (NUC_BORBU, NP_212545). Нумерация аминокислот дана по послеовательности нуклеазы краба. Введенные разрывы обозначены точками. Остатки, характерные для NUC-мотива выделены черным фоном (наиболее консервативные) или серым. Аминокислоты, входящие в состав активного центра ферментов обозначены звездочками.

2.2. Энзиматические характеристики нуклеазы камчатского краба.

Аналогично другим представителям семейства неспецифичных ДНК/РНК-нуклеаз, фермент краба для проявления активности требует присутствия ионов Mg2+ (для оптимальной активности неоходимо 7 mM магния) и ингибируется EDTA. ДНКазная активность очищенной нуклеазы, определенная с помощью модифицированного метода Куница (Kunitz, 1950; Liao, 1974) составила около 18000 единиц Куница на 1 мг белка.

Оптимальный pH находился в интервале 7–8, оптимальная температура составила 55–65°C.

Фермент оставался стабильным при pH выше 6 и температурах ниже 75°C.

Интересно, что фермент проявлял наибольшую активность на двуцепочечной ДНК и был практически неактивен на одноцепочечных молекулах ДНК (рис. 7). Более того, хотя фермент камчатского краба был классифицирован на основании сравнения с другими белками как неспецифичная ДНК/РНК-нуклеаза, он не проявлял заметной активности на молекулах РНК. Однако фермент эффективно разрушал ДНК цепь в ДНК-РНК гетеродуплексе. На основании полученных характеристик фермент был назван дуплексспецифичной нуклеазой (Duplex-Specific Nuclease, DSN).

A B 1 2 3 1 DNA M13 DNA 40 TAMRA-5'-tgggcagtgctcgcttagtg-3’-DABCYL 20-mer ss-DNA 20-mer ds-DNA TAMRA-5'-tgggcagtgctcgcttagtg-3’-DABCYL 3’-acccgtcacgagcgaatcac-5’ 0 10 20 30 40 50 Time, min Рис. 7. Определение предпочтения нуклеазы краба к структурным особенностям ДНК-субстратов. (A) Действие нуклеазы краба на одночепочечную ДНК фага M13 и двуцепочечную ДНК фага . Дорожки 1, 2 – отрицательный контроль, инкубированный без нуклеазы. 1 – ДНК фага M13, 2 – смесь ДНК фага M13 и фага .

Дорожки 3; 4 – обработанная нуклеазой краба при 70°C в течение 1.5 мин (дорожка 3) и 5 мин (дорожка 4) смесь ДНК фага M13 и фага . (B) Действие нуклеазы краба на синтетический одноцепочечный и двуцепочечный ДНК-субстрат длиной 20 нуклеотидов. Интенсивность флуоресценции измеряли при 570 nm (с возбуждением при 550 nm). Относительное увеличение флуоресценции (RFI) определяли как RFI= (Fi-Fo/FmaxFo) x 100%, где Fi интенсивность флуоресценции субстрата после обработки нуклеазой, Fo – флуоресценция в отсутствие фермента, и Fmax – флуоресценция субстрата, разрушенного на 100%. Для построения кривой были усреднены результаты трех повторностей эксперимента (показаны стандартные отклонения каждого значения).

Исследование активности DSN с использованием синтетических олигонуклеотидных субстратов показало способность фермента различать полностью комплементарные и содержащие хотя бы одно неспаренное основание короткие ДНК-дуплексы (длиной 8–12 пн) (рис. 8). Данная способность фермента натолкнула нас на разработку подхода к детекции однонуклеотидных полиморфизмов, который мы назвали DSNP (DSN Preference assay).

2.3. Принцип метода DSNP.

Схема осуществления метода DSNP показана на рисунке 9. Вначале фрагмент ДНК, содержащий определяемый полиморфизм, амплифицируют при помощи ПЦР. После амплификации продукт реакции смешивают с ферментом DSN и двумя (или более, по числу вариантов полиморфизма) олигонуклеотидными пробами длиной около 10 нуклеотидов, мечеными флуорофором и гасителем флуоресценции таким образом, что каждая из проб в RFI случае разрушения дает флуоресценцию определенной длины волны. Каждая из проб комплементарна одному из вариантов последовательности. В результате работы фермента продукт ПЦР разрушается до относительно коротких фрагментов, эффективно гибридизующихся с пробами при температуре инкубации. Пробы, образующие совершенный дуплекс, разрушаются нуклеазой, что ведет к появлению флуоресценции.

Рис. 8. Результаты действия DSN на содержащий замену (A и B) и совершенный (C) ДНК-дуплекс. Дуплексы были образованы меченой 5-carboxyfluorescein (Fl)-5'-gccctatagt-3'-TAMRA пробой и комплементарной цепью ДНК. Обработка ферментом велась при 35°C в течение 15 мин. Спектры испускания были получены при помощи спектрофлуориметра с возбуждением при 480 nm. Синяя линия – флуоресценция субстрата в отсутствие фермента; зеленая линия – флуоресценция после обработки ферментом.

Для увеличения интенсивности сигнала реакцию проводят в присутствии фрагмента Кленова, дефектного по экзонуклеазной активности (KF(exo-)) и катализирующего синтез ДНК на одноцепочечных разрывах, возникающих вследствие работы нуклеазы.

Синтезированные таким образом цепи ДНК снова участвуют в гибридизации с пробами, повышая интенсивность сигнала в 5–20 раз.

В описанном примере мы использовали пробы, одновременно добавляемые в одну пробирку и меченые разными флуорофорами. Однако возможно использование и одноцветных проб при проведении реакции в отдельных пробирках.

2.4. Исследование механизма действия фермента.

Для определения возможности использования данного подхода для разных полиморфизмов, был создан набор схожих по последовательности 18-членных олигонуклеотидов, отличающихся лишь единичными заменами. Также, был создан набор проб длиной 10 оснований, полностью комплементарных указанным олигонуклеотидам и содержащих единственную замену (таблица 2).

Пробы были помечены 5карбоксифлуоресцеином (Fl) на 5'конце и флуоресцирующим гасителем TAMRA или темновым гасителем DABCYL на 3'-конце. Все возможные комбинации между 18-членными олигонуклеотидами и пробами были Рис. 9. Схема работы метода определения ОНП с исследованы на возможность использованием дуплекс-специфичной нуклеазы. Зеленым кружком обозначен первый донор флуоресценции, разрушения нуклеазой.

красным – второй донор флуоресценции. Синий кружок показывает гаситель флуоресценции.

Наблюдаемое изменение флуоресценции для всех дуплексов, содержащих неспаренные основания, было примерно в 10 раз ниже, чем для полностью комплементарных дуплексов в экспериментах с пробами, мечеными Fl-TAMRA (таблица 2). Какого либо предпочтения DSN к положению неспаренного нуклеотида выявлено не было. Для проб, меченых Fl-DABCYL, хорошее различие в сигнале от совершенных дуплексов и дуплексов с заменой наблюдалось в случае расположения неспаренного основания на 5'-конце или в центре. Дуплексы с заменами вблизи 3'-конца пробы (например T1–T4) разрушались нуклеазой лишь в 1,5 – 5 раз менее эффективно, чем совершенные дуплексы.

Таким образом, было установлено, что эффективность нуклеазной реакции может зависеть от меток, используемых при синтезе проб.

Таблица 2. Сравнение действия нуклеазы краба на совершенные и содержащие неспаренные основания нуклеотидные ДНК-дуплексы. Дуплексы были получены из 10-членных флуоресцентно-меченых проб и 18членных синтетических олигонуклеотидов, комплементарных пробам. Значения флуоресцентного сигнала, F, были нормированы по формуле: F = Fi - Fo, где Fi – флуоресценция субстрата после обработки ферментом, а Fo – флуоресценция перед началом реакции. Таким образом было определено отношение активности DSN на содержащих не спаренные основания (Fm) и совершенных (Fp) ДНК-дуплексах.

Структура олигонуклеотидов, Fm/Fp комплементарных пробам для флуоресцентно-меченой пробы:

(подчеркнута последовательность, Название образующая дуплекс с пробой; позиция Fl-5'-gccctatagt-3'- Fl-5'-gccctatagt-3'неспаренного основания обозначена TAMRA DABCYL заглавной буквой) TP 5’-actcactatagggcgaat-3’ 1,00 1,5’-actcCctatagggcgaat-3’ T1C 0,04 0,5’-actcGctatagggcgaat-3’ T1G 0,04 0,5’-actcTctatagggcgaat-3’ T1T 0,04 0,5’-actcaAtatagggcgaat-3’ T2A 0,05 0,5’-actcaGtatagggcgaat-3’ T2G 0,02 0,5’-actcaTtatagggcgaat-3’ T2T 0,02 0,5’-actcacAatagggcgaat-3’ T3A 0,02 0,5’-actcacCatagggcgaat-3’ T3C 0,01 0,5’-actcacGatagggcgaat-3’ T3G 0,02 0,5’-actcactCtagggcgaat-3’ T4C 0,02 0,5’-actcactGtagggcgaat-3’ T4G 0,03 0,5’-actcactTtagggcgaat-3’ T4T 0,03 0,5’-actcactaAagggcgaat-3’ T5A 0,01 0,5’-actcactaCagggcgaat-3’ T5C 0,03 0,5’-actcactaGagggcgaat-3’ T5G 0,02 0,5’-actcactatCgggcgaat-3’ T6C 0,06 0,5’-actcactatGgggcgaat-3’ T6G 0,04 0,5’-actcactatTgggcgaat-3’ T6T 0,01 0,5’-actcactataAggcgaat-3’ T7A 0,03 0,5’-actcactataCggcgaat-3’ T7C 0,01 0,5’-actcactataTggcgaat-3’ T7T 0,06 0,5’-actcactatagAgcgaat-3’ T8A 0,04 0,5’-actcactatagCgcgaat-3’ T8C 0,05 0,5’-actcactatagTgcgaat-3’ T8T 0,06 0,5’-actcactataggAcgaat-3’ T9A 0,05 0,5’-actcactataggCcgaat-3’ T9C 0,08 0,5’-actcactataggTcgaat-3’ T9T 0,07 0,5’-actcactatagggAgaat-3’ T10A 0,03 0,5’-actcactatagggGgaat-3’ T10G 0,07 0,5’-actcactatagggTgaat-3’ T10T 0,05 0,2.5. Модельные эксперименты.

Предлагаемый подход был опробован для выявления аллельного состояния однонуклеотидных полиморфизмов. Сначала был определен оптимальный для метода DSNP размер продукта ПЦР. Для этого были получены фрагменты размером 952, 534 и 69 пн, содержащие C- или T- варианты полиморфной последовательности митохондриальной ДНК человека C7028T (ген COX1). Фрагменты гибридизовали с T-специфичной пробой по методу DSNP. Четкие и однозначные результаты были получены для всех использованных продуктов ПЦР (рис. 10). Более того, в качестве исследуемой ДНК была использована плазмида (около 4 тпн), содержащая фрагмент гена COX1 размером 69 пн (рис. 10). Данные эксперимента ясно показали возможность использования в методе DSNP фрагментов ДНК различной длины.

Метод DSNP с пробами, мечеными разными флуорофорами был применен нами для детекции полиморфизмов, ассоциированных с предрасположенностью к заболеваниям. В частности, мы проанализировали полиморфизм G20210A в гене протромбина, ассоциированный с повышенным риском венозного тромбоза и инфарктом миокарда (Poort et al., 1996), полиморфизм C677T в гене метилентетрагидрофолат редуктазы (MTHFR), Рис. 10. Определение полиморфизма C7028T в гене COX1 митохондриальной ДНК человека при ассоциированный с повышенным уровнем помощи предложенного метода. Продукты ПЦР длиной 69, 534 и 952 пн, содержащие варианты гомоцистеина в плазме и развитием сердечно7028T или 7028C, и плазмида pT-Adv, содержащая в качестве вставки фрагмент длиной 69 пн были сосудистых заболеваний (Frosst et al., 1995) и использованы для тестирования с T-вариантом полиморфизм C309T в гене p53, флуоресцентно-меченой пробы. “DSN+” – реакция с ферментом; “DSN-” – отрицательный контроль ассоциированный с развитием карцином без фермента. Отношение Fm/Fp было определено как описано в таблице 2. (A) Фрагмент (Abarzua et al., 1995) для гомозиготных и ПЦР-планшета сфотографирован при помощи флуоресцентного стереомикроскопа Olympus гетерозиготных образцов (рис. 11). Все SZX12 с зеленым фильтром. (B) ПЦР-пробирки с результатами исследования фрагмента длиной 69 результаты, полученные с помощью метода пн, сфотографированные при помощи Multi Image DSNP были подтверждены определением Light Cabinet (Alpha Innotech Corporation) в ультрафиолетовом свете. Яркий сигнал последовательности нуклеотидов ДНК по наблюдается только для пробирок с правильным вариантом пробы и ферментом.

Сэнгеру.

Таким образом, обнаружена новая нуклеаза (DSN), обладающая уникальными свойствами. На основе анализа аминокислотной последовательности, новый фермент классифицирован как член семейства неспецифичных ДНК/РНК-нуклеаз. Ферменты, относящиеся к данному семейству, как правило, разрушают все типы нуклеиновых кислот со сходной специфичностью к РНК, одноцепочечной или двуцепочечной ДНК (Friedhoff et al., 1996; Ho et al, 1998; Meiss et al., 1998). Для нескольких нуклеаз данного семейства было показано отсутствие или очень низкая РНКазная активность (Ho and Liao, 1999; Wang et al., 2000), однако никаких различий в эффективности разрушения одноцепочечной или двуцепочечной ДНК у представителей семейства обнаружено не было.

Рис. 11. Анализ полиморфизмов p53 C309T, протромбин G20210A и MTHFR C677T в гомо- и гетерозиготных образцах ДНК при помощи метода DSNP. (A) Фотографии получены при помощи флуоресцентного стереомикроскопа с зеленым (G) и красным (R) фильтрами. GR – компьютерное наложение изображений, полученных на разных фильтрах. C/C и T/T – гомозиготные образцы ДНК, C/T – гетерозиготный образец ДНК.

(B) Нормированные спектры испускания образцов, показанных на рис. (A), полученные при помощи спектрофлуориметра, с возбуждением при 480 nm (для зеленой флуоресценции) и 550 nm (для красной флуоресценции). Значения флуоресценции определяли как описано в таблице 2. Зеленая линия – гомозиготный образец ДНК C/C, красная линия – гомозиготный образец ДНК T/T, синия линия – гетерозиготный образец ДНК.

DSN представляет собой новый тип неспецифичных нуклеаз, не проявляющий (или проявляющий очень низкую) РНКазную активность и обладающий существенным предпочтением при расщеплении двуцепочечной ДНК в сравнении с одноцепочечной ДНК.

Фермент стабилен в широком диапазоне значений pH и температур и нечувствителен к обработке протеиназами. Данные особенности фермента указывают на возможность его использования в методах анализа молекул ДНК.

Нуклеазная активность DSN на совершенных ДНК-дуплексах выше таковой на дуплексах даже с единичными некомплементарными парами оснований. Наиболее существенно данная особенность проявляется на фрагментах длиной около 8–12 пн.

На основе полученных характеристик фермента разработан новый, достаточно простой и возможный для автоматизации, метод определения однонуклеотидных полиморфизмов (DSNP). Наиболее существенными преимуществами метода DSNP являются: 1) возможность использования неочищенных продуктов ПЦР, 2) отсутствие этапов сепарации и центрифугирования, 3) короткое время до получения результатов (менее 1 часа с момента получения продуктов ПЦР). Метод DSNP не требует дорогого оборудования. Специфичный сигнал флуоресценции может быть обнаружен с использованием стандартного лабораторного оборудования. Так, в случае использования проб, меченых флуоресцеином, специфичный сигнал можно регистрировать даже под обычным ультрафиолетом, используемым для визуализации ДНК после гель-электрофореза.

За счет использования в одной пробирке проб, меченых разными флуорофорами, метод позволяет обнаружить отсутствие наработки ПЦР-продукта в ходе предварительной амплификации, а доказанная возможность использования в методе DSNP длинных фрагментов ДНК дает возможность проводить детекцию сразу нескольких близко расположеных полиморфизмов в одной пробирке (при условии использования набора проб, меченых разными флуорофорами). Также, можно использовать мультиплексную ПЦР для получения нескольких продуктов с последующим анализом DSNP. Наконец, предлагаемый поход пригоден для крупномасштабного скрининга полиморфизмов, путем размещения необходимого количества проб на твердофазной подложке.

3. Усовершенствование технологии детекции однонуклеотидных полиморфизмов на основе аллель-специфичной полимеразной цепной реакции с использованием ПЦР «в реальном времени» с флуоресцентно-мечеными олигонуклеотидными пробами или праймерами.

3.1. Повышение степени дискриминации аллелей при проведении аллель-специфичной ПЦР в одной пробирке за счет дополнительных нуклеотидных замен.

Одним из методов детекции однонуклеотидных полиморфизмов является использование двух пар праймеров, в каждой из которых один из праймеров общий для двух аллелей, а другой – аллель-специфичный (полностью комплементарный только одному из существующих вариантов последовательности ДНК). Нуклеотид, дискриминирующий аллели, располагают в 3'-концевой позиции аллель-специфичных праймеров. ПЦР для каждой пары проводят в отдельных пробирках. Если при этом использовать одинаковое стартовое количество исследуемой ДНК и правильно подобрать число циклов реакции, то при анализе продуктов ПЦР по окончании реакции (например, методом электрофореза в агарозном геле) можно наблюдать наличие продукта ПЦР в тех пробирках, где затравка образует совершенный дуплекс с матрицей и его отсутствие в пробирках с несовершенным дуплексом (рис. 12 и 13).

Проведение аллель-специфичной ПЦР в одной пробирке одновременно для двух аллелей имеет ряд преимуществ. Первое преимущество очевидно: вместо приготовления двух реакций достаточно одной. Все компоненты реакции общие и искажение результатов за счет ошибки смешивания исключено. Но есть и другое существенное преимущество:

поскольку разница в количестве продукта с каждого из аллель-специфичных праймеров определяется на первых циклах реакции (различие вносит лишь отжиг праймеров на исходную молекулу ДНК), присутствие обоих аллель-специфичных праймеров в одной реакции теоретически должно вести к их конкуренции за отжиг на первоначальную ДНКматрицу и, как следствие, к лучшему различению аллелей.

При проведении аллель-специфичной ПЦР в одной пробирке необходимо отдельно детектировать продукты, полученные с каждого из аллель-специфичных праймеров. Для этого используют разнообразные варианты мечения каждого из праймеров, которые подробнее описаны ниже.

Рис. 12. Гибридизация аллель-специфичных праймеров. Синие и красные стрелки обозначают аллель-специфичные праймеры, черные линии – цепи ДНК. «Красный» праймер соответствует аллелю 1, «синий» – аллелю 2. В случае отжига праймера с образованием несовершенного дуплекса, полимераза без 3'-экзонуклеазной (корректирующей) активности использует его как затравку существенно реже.

Рис. 13. Пример графиков накопления ДНК, полученных с использованием детектирующего амплификатора («ДТ-322», «НПФ ДНК-Технология», Россия). А. Результат исследования гомозиготного образца ДНК (кривые изображены в линейном масштабе). Синяя кривая соответствует накоплению продукта реакции с праймера, содержащего 3'-концевой неспаренный нуклеотид. Б. Результат исследования гетерозиготного образца (кривые изображены в линейном масштабе). В. Результат исследования гомозиготного образца (кривые изображены в логарифмическом масштабе). Г. Результат исследования гетерозиготного образца (кривые изображены в логарифмическом масштабе). Параллельность линейных участков кривых накопления ДНК (рис. В и Г) отражает схожую эффективность реакции для каждой пары праймеров независимо от генотипа исследуемого образца.

Однако данный эффект может быть существенно нивелирован процессом, неизбежно происходящим при проведении аллель-специфичной ПЦР в одной пробирке: с накоплением продуктов ПЦР с одного из аллель-специфичных праймеров, с ампликонами гибридизуется и второй – «неправильный» – олигонуклеотид, а полимераза в некотором проценте случаев его удлиняет. Таким образом, эффект начального «отрыва» полностью комплементарного матрице аллель-специфичного праймера может быть существенно снижен за счет описанного процесса.

Для преодоления данного негативного эффекта было предложено вносить дополнительные замены в 3'-область аллель-специфичных олигонуклеотидов. Был протестирован набор праймеров с различным расположением замен относительно 3'-конца. В таблице 3 приведены последовательности аллель-специфичных праймеров типа «амплифлюр» и типа «скорпион», использованных при проверке эффективности снижения кросс-гибридизации.

Таблица 3. Последовательности флуоресцентно-меченых праймеров с различным положением замен (система для определения полиморфизма Factor II G20210A). Цветом выделено положение дополнительной замены.

Название Последовательность олигонуклеотида F2–S1g (FAM)–5'–TAAAAGTGACTCTCAGC–(BHQ1)–GCACTGGGAACATTGAGGCTC–3' F2–S1a (HEX)–5'–TAAAAGTGACTCTCAGC–(BHQ1)–GCACTGGGAACATTGAGGCTT–3' F2–S2g (FAM)–5'–TAAAAGTGACTCTCAGC–(BHQ1)–GCACTGGGAACATTGAGACTC–3' F2–S2a (HEX)–5'–TAAAAGTGACTCTCAGC–(BHQ1)–GCACTGGGAACATTGGGGCTT–3' F2–S3g (FAM)–5'–TAAAAGTGACTCTCAGC–(BHQ1)–GCACTGGGAACATTGAAGCTC–3' F2–S3a (HEX)–5'–TAAAAGTGACTCTCAGC–(BHQ1)–GCACTGGGAACATTAAGGCTT–3' В ходе исследования было установлено, что наиболее удачным является расположение дополнительных замен в четвертом положении считая от 3'-конца праймера для одного аллель-специфичного праймера и в шестом положении – для другого праймера.

Такое расположение замен позволяет при минимальном снижении эффективности ПЦР достигать наибольшей дискриминации аллелей при исследовании гомозиготных образцов.

3.2. Методика исключения ложноположительных результатов при использовании аллель-специфичных праймеров типа «амплифлюр» за счет использования дополнительной флуоресцентно-меченой гибридизационной пробы.

В варианте метода с использованием олигонуклеотидов типа амплифлюр аллель- специфичные праймеры несут на 5'-конце адаптерную последовательность, способную формировать шпилечную структуру (типа стебель-петля). Адаптеры несут флуоресцентные метки и гасители флуоресценции, расположенные так, что при образовании шпилечной структуры флуорофор и гаситель оказываются сближены и сигнал не появляется. В растворе праймеры сохраняют структуру шпильки, имеющую низкий уровень флуоресценции. В ходе реакции шпилька раскрывается (поскольку меченый праймер становится частью двухцепочечного продукта), что приводит к усилению сигнала (Winn-Deen, 1998). Описан вариант метода, в котором гаситель находится на отдельном олигонуклеотиде, комплементарном 5'-концевой адаптерной последовательности (Fiandaca et al., 2001). В этом случае при удлинении праймера гибридизация с гасящим олигонуклеотидом оказывается невозможной.

Существенным недостатком метода является появление сигнала при накоплении неспецифичных продуктов реакции. Для преодоления данного недостатка было предложено добавить в систему дополнительную флуоресцентно-меченую гибридизационную пробу.

При использовании отдельной гибридизационной пробы специфичная амплификация должна вести к возрастанию сигнала как от флуоресцентно-меченого праймера, так и от флуоресцентно-меченой олигонуклеотидной гибридизационной пробы и, таким образом, отличаться от ситуации неспецифичной амплификации, когда сигнал будет образовывать лишь праймер.

Предложенная схема постановки реакции была успешно опробована на 5 тестсистемах для определения однонуклеотидных полиморфизмов: MTHFR C677T, MTHFR A1298C, Factor II G20210A, Factor V G1691A и ACTN3 R577X. Последовательности флуоресцентно-меченых олигонуклеотидов для двух из пяти перечисленных систем приведены в таблице 4.

Таблица 4. Последовательности флуоресцентно-меченых праймеров и флуоресцентно-меченых проб тестсистем для дискриминации аллелей в гене метилентетрагидрофолатредуктазы. Строчные буквы показывают добавленные нуклеотиды, отсутствующие в исходной последовательности.

Название Последовательность олигонуклеотида MTH–a1c (BHQ1)–agacAGAAGGTGTC(FdT)GCGGGAGC MTH–a1t (BHQ1)–agacAGAAGGTGTC(HdT)GCGGGAGT MTH–pt1 (BHQ1)–5'–TGTCGGTGCAGCCTTCACAAAGCGGA–3'–СyHFR–a1a (BHQ1)–agctcGGGAGGAGC(FdT)GACCAGTGAAGA HFR–a1c (BHQ1)–agctcGGGAGGAGC(HdT)GACCAGTGAAGC HFR–pt1 (BHQ1)–5'–TGACCATTCCGG(FdT)TTGGTTCTCCCGA–3'–Сy4. Разработка алгоритма проведения исследования и анализа результатов ПЦР «в реальном времени», повышающего точность и воспроизводимость метода.

4.1. Алгоритмы анализа графиков накопления ДНК в ходе ПЦР.

В настоящее время для регистрации накопления продуктов ПЦР «в реальном времени» применяют специальное оборудование – детектирующие амплификаторы, способные регистрировать уровень флуоресценции в реакционной пробирке непосредственно в ходе реакции. По окончании ПЦР исследователь получает графики накопления ДНК, изображенные в координатах уровень флуоресценции/цикл амплификации (рис. 14). Для визуализации накопления ДНК в ходе ПЦР используют интеркалирующие красители, меченые праймеры, меченые олигонуклеотидные пробы и различные комбинации этих методов (Tyagi et al., 1996; Morrison et al., 1998; Winn-Deen, 1998; Thelwell et al., 2000).

Получаемые при помощи детектирующих ПЦР-амплификаторов исходные (необработанные) графики накопления ДНК содержат вклад ряда внешних (не обусловленных исследуемым процессом, «небиологических») факторов, искажающих результаты эксперимента. На форму кривых влияет неполная идентичность состава реакционных смесей, разброс оптических свойств пробирок, неоднородности оптической схемы детектирующих амплификаторов, шумы электроники и т.д. Для снижения влияния таких факторов на результаты исследования современные алгоритмы анализа графиков накопления ДНК включают в себя этап нормировки данных.

Анализ результатов ПЦР «в реальном времени» можно проводить несколькими принципиально разными способами (Pfaffl, 2001; Livak et al., 2001; Liu et al., 2002; Bar et al., 2003). Однако независимо от способа анализа результатов, в случае количественного ПЦРисследования, необходимо сравнить полученные графики накопления ДНК для нескольких образцов (например, исследуемый образец со стандартным или исследуемые образцы между собой). От правильности такого сравнения в первую очередь зависит точность всего исследования. Предлагаемые производителями детектирующих амплификаторов и программного обеспечения методы сравнения кривых существенно отличаются по точности и устойчивости к слабому сигналу. В данном случае речь идет не об абсолютной силе сигнала, который обычно высок и зарегистрировать его современными аппаратами не составляет труда, а о соотношении уровня сигнала и фоновой флуоресценции (Teo et al., 2002; Ball et al., 2003).

Задача корректного сравнения графиков непроста, поскольку на практике всегда существует ряд факторов «небиологической» природы, искажающих получаемые результаты (таких, как ошибки приготовления реакций, разброс оптических свойств пробирок, неоднородности оптической схемы детектирующих амплификаторов и т.д.). При всем стремлении производителей оборудования и расходных материалов к техническому совершенству приборов, полностью убрать влияние «небиологических» факторов невозможно. Вместе с тем, его можно существенно снизить за счет использования математических методов обработки сигнала.

Данная честь работы была направлена на создание способа нормировки данных ПЦР «в реальном времени», существенно снижающего влияние факторов «небиологической» природы. Предложен новый подход, основанный на определении разницы уровней флуоресценции при двух температурах в ходе нескольких первых циклов ПЦР, с последующим использованием полученных значений для нормировки графиков накопления ДНК.

4.2. Метод delta-ТF нормировки данных ПЦР «в реальном времени».

На рис. 14А приведён пример исходных (необработанных) графиков изменения интенсивности флуоресценции для двух идентичных реакций в одном эксперименте.

Поскольку все компоненты реакционных смесей одинаковы, наблюдаемые различия обусловлены факторами «небиологической» природы, такими как погрешности приготовления и разнесения по отдельным пробиркам реакционной смеси, неоднородность температуры термоблока амплификатора, искажения оптического тракта прибора, разброс оптических параметров реакционных пробирок и т.д.

Рис. 14. Пример применения метода delta-TF нормировки. Графики показывают типичные результаты ПЦР «в реальном времени» для двух идентичных реакций в одном эксперименте. Различия в форме кривых обусловлены разницей в интенсивности флуоресценции образов вследствие неточности приготовления реакционных смесей, неоднородности прозрачности амплификационных пробирок, неоднородностью оптического тракта амплификатора и т.д. (А) не обработанные данные; (Б) то же, что и (А) после вычитания фоновой составляющей; (В) не обработанные данные для метода delta-TF; (Г) данные, нормированные при помощи метода delta-TF.

Для сравнения показанных на Рис. 14А кривых обычно используют один из двух основных подходов к анализу результатов ПЦР «в реальном времени»: пороговый метод (определение значения порогового цикла реакции Ct как точки пересечения графика накопления ДНК и пороговой линии) или метод прямого сравнения кривых (определение значения некоторой точки Cp на графике накопления ДНК по форме кривой, например – метод максимума второй производной). Оба подхода предполагают нахождение значения на оси абсцисс (дробного значения цикла реакции), характеризующего данную кривую (найденное значение обычно обозначают как Ct в случае пороговых методов или Cp для методов, использующих анализ формы кривой). Полученные значения используют далее при сопоставлении результатов ПЦР для разных образцов.

Следует отметить, что методы анализа формы кривой более устойчивы к вкладу «небиологических» факторов (разброс значений фоновой флуоресценции и диспропорция масштаба графиков накопления ДНК), однако в случае неэкспоненциальной амплификации и при низком уровне флуоресцентного сигнала они проигрывают методам Ct. На наш взгляд, наиболее эффективным должен быть алгоритм, сочетающий в себе преимущества обеих методик, то есть использующий пороговый метод после вычитания вклада «небиологической» составляющей.

Чаще всего, предварительная обработка кривых в методе Ct ограничивается вычитанием фоновой составляющей и приведением графиков к одному базовому уровню.

Такое преобразование дает результат, показанный на Рис. 14Б. В ряде случаев кривые умножают на нормировочный коэффициент, получаемый по флуоресценции дополнительного красителя (алгоритм компании Эпплайд Биосистемз, США) или флуоресценции собственно реакционной смеси перед началом амплификации (алгоритм компании Био-Рад, США). Однако рассчитанный по единственному начальному значению флуоресценции нормировочный коэффициент не дает достаточно информации для корректного вычитания, зачастую приводя к еще большему искажению данных.

Предлагаемый в данной работе метод позволяет получить адекватный нормировочный коэффициент используя не одно, а два значения фоновой флуоресценции для каждой реакции. Метод основан на том, что одно из находящихся в пробирке флуоресцирующих веществ должно обладать заметной зависимостью интенсивности флуоресценции от температуры. Разница в интенсивности флуоресценции содержимого одной пробирки при разных температурах позволяет выявить и скорректировать вклад неоднородностей «небиологической» природы в результирующую кривую.

На Рис. 14В показан пример графиков, полученных с использованием предлагаемой методики. На всех циклах реакции измерение уровня флуоресценции проводят при температуре T1. Для нескольких первых циклов (в примере – с 5 по 10) выполняют дополнительные измерения при температуре Т2. Затем, по полученным значениям T1 и Tдля каждой реакционной смеси (Ki) определяют калибровочный коэффициент по формуле:

Ki=1/(Fi(T2)-Fi(T1)), где Fi(T2) и Fi(T1) – интенсивности флуоресцентного излучения вещества с выраженной зависимостью уровня флуоресценции от температуры (калибровочная проба) при температурах Т2 и Т1 в i-той реакционной смеси. Нормализованную интенсивность флуоресцентного сигнала каждой реакционной смеси (Fi(n)норм) рассчитывают по формуле:

Fi(n)норм = Ki*( Fi(n)- Bi), где Fi(n) – регистрируемая интенсивность флуоресцентного сигнала в i-той реакционной смеси для n-ного цикла ПЦР, а Bi – интенсивность фонового сигнала (Bi(n) при использования алгоритма, учитывающего линейное изменение фона).

На Рис. 14Г показан результат нормировки кривых по приведенному выше методу.

Видно, что использование двухтемпературного считывания сигнала позволяет убрать разброс фоновой флуоресценции и диспропорцию масштаба графиков накопления ДНК для разных пробирок. На Рис. 15 показаны величины, используемые при расчёте коэффициентов Ki и Fi(n)норм.

Рис. 15. Параметры, используемые при расчете по методу delta-ТF. B1 – фоновая флуоресценция реакции 1; B2 – фоновая флуоресценция реакции 2; Fi(T1) – интенсивность флуоресценции реакции i при t = T1; Fi(T2) – интенсивность флуоресценции реакции i при t = T2.

Эффективность предлагаемого метода можно проиллюстрировать на примере, в котором смоделирован разброс значений фоновой флуоресценции и диспропорцию масштаба графиков накопления ДНК. По 4 идентичных ПЦР были выполнены как указано в разделе «Материалы и методы» для трех образцов ДНК с концентрацией X, 0,1X и 0,01X. В качестве флуоресцирующего вещества с зависящей от температуры интенсивностью флуоресценции использовали пробу типа «молекулярный маячок» (Tyagi et al., 1996). В ходе выполнения циклов ПЦР с 4 по 13 интенсивность флуоресценции определяли дважды на каждом цикле реакции при температурах 94С и 60С (Рис. 16В). Для возможности сравнения классического варианта нормировки и метода delta-TF, из полученных данных программным способом исключили дополнительные измерения при температуре 94С, получив, таким образом, классические графики накопления ДНК (Рис. 16А). Уровень фоновой флуоресценции определяли путем аппроксимации прямой на основе измерений при температуре 60С для циклов с 4 по 13.

Рис. 16. Пример практического использования метода delta-ТF нормировки. На графиках приведены результаты ПЦР «в реальном времени» для четырех идентичных реакций со стартовой концентрацией ДНК X, четырех идентичных реакций со стартовой концентрацией ДНК 0.1X и четырех идентичных реакций со стартовой концентрацией ДНК 0.01X. (А) необработанные данные; (Б) то же, что и (А), но после вычитания фоновой составляющей; (В) необработанные данные, полученные для метода delta-ТF нормировки (с измерением флуоресценции при двух температурах реакционной смеси для циклов 4-13; (Г) данные, нормированные с помощью метода delta-ТF.

Результаты классической нормировки (путем вычитания фоновой составляющей из каждой кривой) и delta-TF нормировки представлены на Рис. 16Б и Г. Полученные данные наглядно демонстрируют преимущество метода delta-TF над обычным приведением графиков к одному базовому уровню за счет вычитания фоновой составляющей.

В таблице 5 приведены стандартные отклонения и коэффициенты вариации для трех разных способов анализа приведенных на Рис. 16 кривых: 1) порогового метода (Ct) после вычитания фоновой составляющей, 2) метода прямого сравнения кривых (Cp) после вычитания фоновой составляющей (использовали метод максимума второй производной) и 3) порогового метода (Ct) после delta-TF нормировки. Приведенные в таблице данные показывают, что для описанного примера метод delta-TF дает существенное улучшение точности исследования в сравнении со стандартным пороговым методом и демонстрирует сопоставимые результаты в сравнении с методом максимума второй производной.

Таблица 5. Стандартные отклонения и коэффициенты вариации для результатов эксперимента, приведенного на рис. 16 (пояснения в тексте). Std – стандартное отклонение, Cv – коэффициент вариации.

Концентрация ДНК Измеряемая величина Ct Cp delta-TF и Ct 24,9 23,24,2 26,23,Ct (Cp) 24,2 26,23,X 24,3 26,23,Std 0,34 0,0,среднее 24,4 26,23,Cv (для 10 повторностей) 1,4 % 0,2 % 0,2% 27,6 29,27,27,4 29,27,Ct (Cp) 28,0 29,27,0.1X 28,3 29,27,Std 0,40 0,0,среднее 27,8 29,27,Cv (для 10 повторностей) 1,4% 0,4% 0,6% 31,8 33,30,31,2 33,30,Ct (Cp) 31,3 33,30,0.01X 31 30,Std 0,34 0,0,среднее 31,3 33,30,Cv (для 10 повторностей) 1,1% 0,4% 0,3% средний Cv 1,3% 0,4% 0,4% Следует отметить, что сходство полученных результатов для метода delta-TF и метода прямого сравнения кривых вызвано особенностями приведенного примера (влияние «небиологических» факторов на фоне экспоненциальной амплификации и при сильном сигнале) и не отражает равной эффективности применения этих методов на практике. Мы утверждаем, что предлагаемая в данной работе методика более устойчива к воздействию искажающих факторов, совмещая в себе сильные стороны порогового метода и методов анализа результатов по форме кривых.

4.3. Исследование точности метода определения процентного содержания генетически модифицированных ингредиентов в пище с помощью метода ПЦР «в реальном времени».

В соответствии с санитарными правилами Российской Федерации, пороговый уровень содержания генетически модифицированных источников (ГМИ) в продуктах, подлежащих специальной маркировке, устанавливается на уровне 0,9% (аналогичные требования к маркировке предъявляются и в странах Европейского Союза). В настоящее время для определения относительного содержания ГМИ в пищевых продуктах используют тестсистемы, основанные на методе полимеразной цепной реакции «в реальном времени» (Ankilam et al., 2002; Holst-Jensen et al., 2003; Huang et al., 2004). Однако до настоящего времени оставалось неясным, насколько точными могут быть количественные исследования ГМИ с помощью данного метода.

Для характеристики точности определения содержания ГМИ методом ПЦР «в реальном времени» было решено использовать официально утвержденные тест-системы:

систему TaqMan® GMO Maize 35S Detection Kit (Эпплайд Биосистемз, США), рекомендованную Федеральным центром госсанэпиднадзора Минздрава России и систему, рекомендованную Европейской комиссией по пищевым продуктам и потребительским товарам (Van den Eede et al., 2002). Обе системы использовали совместно с тремя распространенными на территории России моделями детектирующих амплификаторов:

АйСайклер АйКью, («Био-Рад», США), РоторДжин 3000 («Корбетт Ресёч», Австралия) и ДТ322 (ЗАО «НПФ ДНК-Технология», Россия).

Для проведения исследования использовали сертифицированный контрольный материал (кукурузную муку IRMM-413-3 1% MON 810 maize Sample Identification № 22(ERM BF413d), производства Института контрольных материалов и методов, Бельгия) с содержанием (по массе) генетически модифицированной кукурузы линии MON 8относительно немодифицированной 1%. Точность изготовления закупленного контрольного материала (по паспорту) составляла 5%. Образцы для исследования получали взвешиванием 100 мг муки стандарта IRMM-413-3 1% MON 810 maize на аналитических весах Sartorius LE324S (класс точности по ГОСТ 24104-2001 (I) специальный).

В качестве калибровочных стандартов использовали образцы ДНК сертифицированного контрольного материала с содержанием ГМИ 0,1, 1 и 5% (IRMM-413-0,1% MON 810 maize (номера А5–А6 в таблице 6), IRMM-413-3 1% MON 810 maize (номера А3–А4 в таблице 6) и IRMM-413-5 5% MON 810 maize (номера А1–А2 в таблице 6) производства Института контрольных материалов и методов, Бельгия). Экстракцию ДНК и ПЦР амплификацию проводили в соответствии с рекомендациями разработчиков тестсистем. Для оценки процентного содержания ГМИ использовали метод относительного количественного определения, при котором в исследуемом образце определяют содержание ДНК генетически модифицированного организма относительно суммарной ДНК данного вида организмов.

Анализ данных ПЦР «в реальном времени» проводили по наиболее распространенному и общепринятому пороговому методу (Giulietti et al., 2001). В данном подходе для каждой кривой накопления ДНК определяют пороговый цикл – Ct (цикл реакции, на котором уровень флуоресценции достигает порогового уровня). Затем определяют разницу между значениями пороговых циклов для сравниваемых продуктов реакции (в случае ГМИ это фрагмент ДНК генетической конструкции и фрагмент геномной ДНК данного вида организмов):

Сt = Сt (чужеродная ДНК) - Сt (ген кукурузы).

Как и указано разработчиками обеих использованных систем, амплификацию чужеродной ДНК и ДНК кукурузы проводили в одной пробирке, используя для их раздельной регистрации специфичные флуоресцентно меченые олигонуклеотидные пробы с различающимися метками.

Расчет содержания ДНК ГМИ относительно общей ДНК кукурузы производилось с использованием калибровочной прямой автоматически (для прибора ДТ-322) или с использованием программы Excel пакета программ MS Office (для приборов АйСайклер АйКью и РоторДжин 3000). Калибровочную прямую строили на основании ПЦР калибровочных стандартов отдельно для каждого эксперимента. Пример определения содержания ГМИ с использованием системы Эпплайд Биосистемз на приборе ДТ-3показан в таблице 6.

Таблица 6. Пример определения содержания ГМИ с помощью системы Эпплайд Биосистемз с использованием прибора ДТ-322 (ЗАО «НПФ ДНК-Технология»). В колонках «Ct-1» и «Ct-2» приведены значения пороговых циклов для амплификации фрагмента ДНК генетической конструкции и фрагмента геномной ДНК кукурузы, соответственно. В колонке «Ct» показана разница значений Ct-1 и Ct-2. В колонке «% ГМИ» указано процентное содержание ГМИ (по паспорту для стандартов и расчетное для исследуемых образцов). Отрицательные контрольные образцы обозначены (К-). Прочерк означает отсутствие продукта реакции.

№ Образец Ct-1 Ct-2 Ct % ГМИ A1 стандарт_5% 35,6 29,1 6,5 5,A2 стандарт_5% 35,8 28,9 6,9 5,A3 стандарт_1% 38,8 28,7 10,1 1,A4 стандарт_1% 38,2 28,7 9,5 1,A5 стандарт_0,1% 42,3 28,6 13,7 0,A6 стандарт_0,1% 42,0 28,7 13,3 0,B2 кукурузная мука 39,9 29,6 10,3 0,B3 кукурузная мука 40,0 29,7 10,3 0,D7 K- - - - - D8 K- - - - - Таблица 7. Результаты многократного исследования образца с 1%-ным содержанием ГМИ. Расчет стандартного отклонения (Std) и коэффициента вариации (Cv) производили с помощью встроенных функций программы Excel пакета программ MS Office.

ЭкспериСистема Прибор Результат (%ГМИ± ±Std) Cv повторностей (%) ± ± мент 1 0,97±0,28 АйСайклер АйКью 2 0,97±0,29 Эпплайд 0,99±0,19 РоторДжин 30Биосистемз 2 0,98±0,24 1 1,00±0,19 ДТ-32 0,99±0,23 1 0,98±0,24 АйСайклер АйКью 2 0,97±0,29 Евро- 1,00±0,20 РоторДжин 30комиссия 2 0,97±0,29 1 1,00±0,19 ДТ-32 0,99±0,23 Всего было произведено по два независимых исследования для каждой из выбранных систем (Эпплайд Биосистемз и Еврокомиссии). Каждое исследование включало серию из образцов. ПЦР проводили на каждом из участвовавших в исследовании приборов, при этом после этапа очистки ДНК образцы тестировали в двух повторностях. Данные всех экспериментов приведены в таблице 7.

Из полученных данных видно, что коэффициент вариации для обеих систем составил 20–30%. Статистически значимых различий между тест-системами Эпплайд Биосистемз и Еврокомиссии, а также между тремя протестированными приборами выявлено не было.

Следует отметить, что использование реактивов разных серий в одном исследовании ведет увеличению Cv еще на 5–10% по сравнению с приведенными значениями.

Таким образом, при определении процентного содержания ДНК генетически модифицированных источников в пищевых продуктах методом ПЦР «в реальном времени» ошибка измерения составляет 20–30%. Мы считаем, что регламентирующие проведение подобных исследований нормативные документы должны указывать допустимую ошибку измерения в 30%, поскольку на настоящий момент метод количественной ПЦР не позволяет достоверно проводить более точное исследование материала с содержанием нуклеиновых кислот ГМИ около 1%. Кроме того, исследование каждого образца желательно проводить в двух или более повторностях с последующим усреднением результатов.

В качестве подходов к повышению точности анализа можно назвать применение автоматизированных систем очистки ДНК и подготовки реакционных смесей, а также применение новых аппаратных и математических решений, направленных на снижение разброса результатов между образцами.

ВЫВОДЫ 1. Впервые показано, что при поиске последовательностей, отличающих близкородственные геномы, эффективность обнаружения дифференциально представленных последовательностей методом вычитающей гибридизации превышает эффективность метода сравнения «полных» последовательностей геномов (с известными 97–98% последовательности генома). При сравнении близкородственных бактериальных геномов процент ложнодифференциальных локусов в случае биоинформационного сравнения составил 12%, а метод вычитающей гибридизации дал только истинно дифференциальные последовательности. Использование метода зеркально-ориентированной селекции при поиске дифференциально представленных транскриптов повышает процент дифференциальных клонов в результирующей библиотеке на порядок.

2. Клонирован ген термостабильной дуплекс-специфичной нуклеазы камчатского краба и определены свойства фермента. Показано, что фермент является неспецифичной нуклеазой, расщепляющей двуцепочечные ДНК и ДНК цепь в ДНК/РНК гетеродуплексах, но не действующей на одноцепочечные молекулы ДНК. Температурный оптимум работы фермента находится в интервале 55–65°С. На основе уникальных свойств фермента разработан метод определения однонуклеотидных полиморфизмов. Новый подход позволяет сократить время исследования с использованием обычных (не детектирующих) амплификаторов до двух раз и, за счет отсутствия стадии электрофореза, полностью автоматизировать процесс.

3. Усовершенствована технология детекции однонуклеотидных полиморфизмов на основе аллель-специфичной полимеразной цепной реакции с использованием ПЦР «в реальном времени». Впервые показана возможность эффективного использования нескольких флуоресцентно-меченых аллель-специфичных праймеров в одной реакции за счет использования дополнительных кросс-мутаций. Предложена методика исключения ложноположительных результатов при использовании аллель-специфичных праймеров за счет использования дополнительной флуоресцентно-меченой гибридизационной пробы.

4. Разработан принципиально новый метод повышения точности ПЦР «в реальном времени» за счет нормировки флуоресцентного сигнала с использованием двухтемпературного чтения.

Доказано преимущество данного подхода перед существующими методиками обработки данных ПЦР «в реальном времени».

5. Установленная точность метода ПЦР «в реальном времени», как инструмента относительного количественного определения, позволяет уточнить существующие нормативные требования по измерению процентного содержания генетически модифицированных ингредиентов в пищевых продуктах и кормах.

СПИСОК РАБОТ, ОПУБЛИКОВАННЫХ ПО ТЕМЕ ДИССЕРТАЦИИ Публикации в изданиях, рекомендованных ВАК:

Обзоры:

1. Кофиади И.А., Ребриков Д.В. Методы детекции олигонуклеотидных полиморфизмов:

аллель-специфичная ПЦР и гибридизация с олигонуклеотидной пробой // Генетика. – 2006. – Т. 42, № 1. – С. 22–32.

2. Ребриков Д.В., Трофимов Д.Ю. ПЦР «в реальном времени»: подходы к анализу данных // Прикладная биохимия и микробиология. – 2006. – Т. 42, № 5. – С. 520–528.

Статьи:

3. Varfolomeev E.E., Schuchmann M., Luria V., Chiannilkulchai N., Beckmann J.S., Mett I.L., Rebrikov D., Brodianski V.M., Kemper O.C., Kollet O., Lapidot T., Soffer D., Sobe T., Avraham K.B., Goncharov T., Holtmann H., Lonai P., Wallach D. Targeted disruption of the mouse Caspase 8 gene ablates cell death induction by the TNF receptors, Fas/Apo1, and DR3 and is lethal prenatally // Immunity. – 1998. – Vol. 9. – P. 267–276.

4. Haselkorn R., Lapidus A., Kogan Y., Vlcek C., Paces J., Ulbrich P., Pacenkova T., Rebrikov D., Milgram A., Mazur M., Cox R., Kyrpides N., Ivanova N., Kapatral V., Los T., Lykidis A., Mikhailova N., Reznik G., Vasieva O., Fonstein M. The Rhodobacter capsulatus genome // Photosynthesis Research. – 2001. – Vol. 70. – P. 43–52.

5. Shagin D.A., Rebrikov D.V., Kozhemyako V.B., Altshuler I.M., Shcheglov A.S., Zhulidov P.A., Bogdanova E.A., Staroverov D.B., Rasskazov V.A., Lukyanov S. A novel method for SNP detection using a new duplex-specific nuclease from crab hepatopancreas // Genome Research. – 2002. – Vol. 12. – P. 1935–1942.

6. Ребриков Д.В., Коган Я.Н. Применение супрессионной вычитающей гибридизации для поиска штаммоспецифичных последовательностей в бактериальных геномах // Генетика. – 2003. – Т. 39, № 10. – С. 1317–1321.

7. Кислицын Ю.А., Ребриков Д.В., Дунаевский Я.Е., Руденская Г.Н. Выделение и первичная структура трипсина камчатского краба Paralithodes camtschaticus // Биоорганическая химия. – 2003. – Т. 29, № 3. – С. 269–276.

8. Rebrikov D.V., Desai S.M., Siebert P.D., Lukyanov S.A. Suppression subtractive hybridization // Methods Mol. Biol. – 2004. – Vol. 258. – P. 107–134.

9. Анисимова В.Е., Ребриков Д.В., Жулидов П.А., Староверов Д.Б., Лукьянов С.А., Щеглов А.С. Ренатурация, активация и практическое использование рекомбинантной дуплекс-специфичной нуклеазы камчатского краба // Биохимия. – 2006. – Т. 71, № 5. – С. 513–519.

10. Абрамов Д.Д., Трофимов Д.Ю., Ребриков Д.В. Точность метода полимеразной цепной реакции «в реальном времени» при определении содержания генетически модифицированных источников в пищевых продуктах // Прикладная биохимия и микробиология. – 2006. – Т. 42, № 4. – С. 485–488.

11. Боринская С.А., Ребриков Д.В., Нефёдова В.В., Кофиади И.А., Соколова М.В., Колчина Е.В., Куликова Е.А., Чернышов В.Н., Куцев С.И., Полонников А.В., Иванов В.П., Козлов А.И., Янковский Н.К. Молекулярная диагностика и распространенность первичной гиполактазии в популяциях россии и сопредельных стран // Молекулярная биология. – 2006. – Т. 40, № 6. – С. 931–935.

12. Ребриков Д.В., Степанова Е.В., Королева О.В., Бударина Ж.И., Захарова М.В., Юркова Т.В., Солонин А.С., Белова О.В., Пожидаева З.А., Леонтьевский А.А. Лакказа лигнолитического гриба Trametes hirsuta: очистка и характеристика фермента, клонирование и определение первичной структуры гена // Прикладная биохимия и микробиология. – 2006. – Т. 42, № 6. – С. 645–653.

13. Кофиади И.А., Ребриков Д.В., Трофимов Д.Ю., Алексеев Л.П., Хаитов Р.М.

Распределение аллелей генов CCR5, CCR2 И SDF1, ассоциированных с устойчивостью к ВИЧ-инфекции, в российских популяциях // Доклады Академии Наук. – 2007. – Т. 415, № 6. – С. 842–845.

14. Кофиади И.А., Ребриков Д.В., Трофимов Д.Ю., Алексеев Л.П., Хаитов Р.М.

Распределение ВИЧ-протективных аллелей генов CCR2, CCR5 и SDF1 в российских популяциях // Иммунология. – 2007. – № 1. – С. 10–12.

15. Соколова М.В., Васильев Е.В., Козлов А.И., Ребриков Д.В., Сенкеева С.С., Кожекбаева Ж.М., Люндуп Н.С., Свечникова Н.С., Огурцов П.П., Хуснутдинова Э.К., Янковский Н.К., Боринская С.А. Полиморфизм C/T-13910 регуляторного участка гена лактазы LCT и распростораненность гиполактазии в популяциях Евразии // Экологическая генетика. – 2007. – Т. 5, № 3. – С. 26–35.

16. Черноусов А.Д., Петрова Т.В., Пичугина Л.В., Литвина М.М., Донецкова А.Д., Кофиади И.А., Ребриков Д.В., Апарин П.Г. Посттерапевтическая клеточная латентность вируса иммунодефицита человека у пациента с исходной развернутой картиной СПИДа // Иммунология. – 2007. – № 6. – С. 327–331.

17. Трофимов Д.Ю., Ребриков Д.В., Саматов Г.А., Семенов П.А., Балуев А.Б., Гончарова Е.В., Алексеев Л.П., Хаитов Р.М. Метод повышения точности ПЦР «в реальном времени» // Доклады Академии Наук. – 2008. – Т.419, №3. – С. 421–424.

18. Стахов В.Л., Губин С.В., Максимович С.В., Ребриков Д.В., Савилова А.М., Кочкина Г.А., Озерская С.М., Иванушкина Н.Е., Воробьева Е.А. Микробные сообщества с поверхности древних семян, извлеченных из многолетнемерзлых отложений плейстоценового периода // Микробиология. – 2008. – Т. 77, № 3. – С. 396– 403.

Публикации в прочих изданиях:

Обзоры и монографии:

19. Rebrikov D.V, Desai S., Kogan Y.N., Thornton A.M., Diatchenko L. Subtractive cloning:

new genes for studying inflammatory disorders // Annal. Periodontol. – 2002. – Vol. 7. – P. 17–29.

20. Rebrikov D.V, Kogan Y.N., Diatchenko L. SSH Subtractive Cloning: Comprehensive Survey Of Genome Differences In Prokaryotes // DelVecchio V.G., Krcmery V., (eds.).

Applications of Genomics and Proteomics for Analysis of Bacterial Biological Warfare Agents. – NATO Science Series, IOS Press, Amsterdam, Netherlands, 2003. – Vol. 352. – P. 95–105.

21. Rebrikov D.V. Identification of Differential Genes by Suppression Subtractive Hybridization // Dieffenbach C.W. Dveksler G.S., (eds.). PCR Primer. A Laboratory Manual. Second Edition. – Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, USA, 2003. – P. 297–325.

Статьи:

22. Kogan Y., Cox R., Silkov E., Overbeek R., Rebrikov D., Maltsev N., Kumar V., Fedosova V., Thomas Sh., Haselkorn R., Fonstein M. Rhodobacter capsulatus genome project. Half Way Through. Microb. Compar. Genomics. – 1998. – Vol. 3. – P. 78–79.

23. Pegasova T.V., Zwart P., Koroleva O.V., Stepanova E.V., Rebrikov D.V., Lamzin V.S.

Crystallization and preliminary X-ray analysis of a four-copper laccase from Coriolus hirsutus // Acta Crystallogr. D. Biol. Crystallogr. – 2003. – Vol. 59. – P. 1459–1461.

24. Rudenskaya G.N., Kislitsin Y.A., Rebrikov D.V. Collagenolytic serine protease PC and trypsin PC from king crab Paralithodes camtschaticus: cDNA cloning and primary structure of the enzymes // BMC Struct. Biol. – 2004. – Vol. 20. – P. e2.

25. Kozhemyako V.B., Rebrikov D.V., Lukyanov S.A., Bogdanova E.A., Marin A., Mazur A.K., Kovalchuk S.N., Agafonova E.V., Sova V.V., Elyakova L.A., Rasskazov V.A.

Molecular cloning and characterization of an endo-1,3-beta-D-glucanase from the mollusk Spisula sachalinensis // Comp. Biochem. Physiol. B. Biochem. Mol. Biol. – 2004. – Vol. 137. – P. 169–178.

26. Semenova S.A., Rudenskaya G.N., Rebrikov D.V., Isaev V.A. cDNA cloning, purification and properties of Paralithodes camtschaticus metalloprotease. Protein Pept. Lett. – 2006. – Vol. 13. – P. 571–575.

27. Kozlov A., Borinskaya S., Vershubsky G., Vasilyev E., Popov V., Sokolova M., Sanina E., Kaljina N., Rebrikov D., Lisitsyn D., Yankovsky N. Genes related to the metabolism of nutrients in the Kola Sami population // Int. J. Circumpolar. Health. – 2008. – Vol. 67. – P. 56–66.

28. Anisimova V.E., Rebrikov D.V., Shagin D.A., Kozhemyako V.B., Menzorova N.I., Staroverov D.B., Ziganshin R., Vagner L.L., Rasskazov V.A., Lukyanov S.A., Shcheglov A.S. Isolation, characterization and molecular cloning of Duplex-Specific Nuclease from the hepatopancreas of the Kamchatka crab // BMC Biochem. – 2008. – Vol. 9. – P. e14.

Материалы всероссийских и международных конференций за последние 3 года:

29. Ребриков Д.В. Варианты детекции продуктов ПЦР «в реальном времени». Третий съезд общества биотехнологов России им. Ю.А.Овчинникова, Москва, Россия, 2005.

30. Ребриков Д.В. ПЦР-диагностика инфекционных заболеваний а полевых условиях.

Симпозиум «Молекулярная диагностика» II-й Международной конференции «Молекулярная медицина и биобезопасность», Москва, Россия, 2005.

31. Кофиади И.А., Морозова С.А., Ребриков Д.В. Частоты аллелей генов CCR5, CCR2 и SDF1, ассоциированных с устойчивостью к ВИЧ-инфекции у россиян.

Международная Конференция «Генетика в России и мире», Москва, Россия, 2006.

32. M.Sokolova, I.Kofiadi, D.Rebrikov, T.Borodina, A.Kozlov, S.Borinskaya, N.Yankovsky.

DNA diagnostics of adult-type hypolactasia in populations of Russia and neighboring countries. Human Genome Meeting, Helsinki, Finland, 2006.

33. Кофиади И.А., Морозова С.А., Ребриков Д.В. Распределение ВИЧ-протективных аллелей генов CCR5, CCR2 и SDF1 у россиян. VI Съезд аллергологов и иммунологов СНГ, Москва, Россия, 2006.

34. I.A.Kofiadi, D.Yu.Trofimov, D.V.Rebrikov. Genetic susceptibility to HIV-1 infection in Russian populations. 21st EFI Conference, Barcelona, Spain, 2035. Ребриков Д.В., Кофиади И.А., Алексеев Л.П., Хаитов Р.М. Полиморфизм генов CCR5, CCR2 И SDF1, ассоциированных с устойчивостью к ВИЧ – инфекции, среди этнических групп, проживающих на территории России и сопредельных государств.

XI Всероссийский научный Форум «Дни иммунологии в Санкт-Петербурге», СанктПетербур, Россия, 2007.

36. Турчанинова М.А., Ребриков Д.В. Профиль внеклеточных РНК в плазме при аллергической реакции. VIII Конгресс «Современные проблемы аллергологии, иммунологии и иммунофармакологии», Москва, Россия, 2007.

37. Кофиади И.А., Ребриков Д.В., Трофимов Д.Ю., Алексеев Л.П., Хаитов Р.М. Анализ распространения ВИЧ-протективных аллелей среди этнических групп, проживающих на территории России и сопредельных государств. VIII Конгресс «Современные проблемы аллергологии, иммунологии и иммунофармакологии», Москва, Россия, 2007.

38. M.Turchaninova, D.Rebrikov. Circulating Nucleic Acids as Potential Biomarker of Allergic Reactions. Fifth International Conference on Circulating Nucleic Acids in Plasma/Serum, Moscow, Russia, 2007.

39. В.В.Ильинский, Д.В.Ребриков, А.Б.Шипунов. Гетерогенность среди видов ольхи (Alnus mill., Betulaceae) севера России: комбинированный подход. Конференция «Вычислительная филогенетика и геносистематика», Москва, Россия, 2007.

40. M.Turchaninova, D.Rebrikov. Circulating Nucleic Acids in Plasma. 2nd Immunodiagnostics & Immunomonitoring Conference, Washington DC, USA, 2007.

41. Turchaninova M.A., Rebrikov D.V. Characterization of Some Cytokines Gene Expression Profile in the Plasma of Patients with Immunological Disorders. 6th Annual Cytokines&Inflammation Conference, Orlando, USA, 2008.

42. Kofiadi I.A., Rebrikov D.V. Genetic susceptibility to HIV in Russian and neighbouring populations. The Second Eastern Europe and Central Asia AIDS Conference (EECAAC), Moscow, Russia, 2008.

Приложение. Перечень тест-систем для определения генетических полиморфизмов, разработанных и внедренных в серийное производство.

№ Название гена Полиморфизм 1 Метилентетрагидрофолатредуктаза MTHFR A1298C 2 Метилентетрагидрофолатредуктаза MTHFR C677T 3 Митохондриальная супероксиддисмутаза 2 MnSOD C/T (exon2) 4 Коагуляционный фактор II Factor II G20210A 5 Коагуляционный фактор V Factor V G1691A 6 Коагуляционный фактор VII F VII G10976A 7 Фибриноген бета FGB G-455A 8 Рецептор 5 СС мотива хемокина CCR5 delta9 Рецептор 2 СС мотива хемокина CCR2 V64I 10 Лиганд 12 CXC мотива хемокина SDF1 3-prime-A 11 G-протеин связанный рецептор киназа 2 GRK4 C1711T 12 Рецептор ангиотензина 1 AT1R A1166T 13 Ангиотензин 1 AGT M235T 14 Ангиотензин 1 AGT G-6A 15 Ангиотензин 1 AGT T174M 16 Ингибитор активатора плазминогена PAI-I (SERPINE1) -675 (4G(-675)5G) 17 Тромбоцитарный рецептор фибриногена ITGB3 (GP IIIa) C /T (L33P) 18 Ген, содержащий анкириновый повтор и киназный домен 1 ANKK1 TaqIA 19 Лактаза LAC C-13910T 20 Митохондриальная супероксид дисмутаза 2 MnSOD Ala(-9)Val 21 Ангиотензин-превращающий фермент ACE Alu I/D 22 Актинин альфа-3 ACTN3 C/T (exon 15) 23 Ангиотензиноген ATG C4072T(exon2) 24 Брадикининовый рецептор BDKRB2 (+9-9) 25 Альфа-2А-адренорецептор ADRA2A C-1291G (promoter) 26 Бета-2-адренорецептор ADRB2 A/G (exon1) 27 Глиальный нейротрофический фактор CNTF G/A (intron1) 28 Рецептор глиального нейротрофического фактора СNTFR C174T (exon9) 29 Катехол-о-метилтрансфераза COMT G472A (exon4) 30 Дофамина рецептор D2 DRD 2 Taq1A T/C (exon8) 31 Дофамина рецептор D3 DRD3 C/T (exon1) 32 Дофамина рецептор D4 DRD4 C-521T (promoter) 33 Серотонина рецептор 1A HTR1A C-1019G (promoter) 34 Серотонина рецептор 2A HTR2A T102C (promoter) 35 Транспортёр норадреналина SLC6A2 T-182C (promoter) 36 Гидроксилаза триптофана 1 TPH1 A779C (intron7) 37 Гидроксилаза триптофана 2 TPH2 G-703T 38 Белок-регулятор динамики микротрубочек Stathmin C/T 39 Фактор роста нейронов BDNF G/A (exon2) 40 Цитохром P450, субсемейства I, полипептид 1 CYP1A1 A4889G 41 Цитохром P450, субсемейства I, полипептид 1 CYP1A1 T6235C 42 Цитохрома P450, субсемейства IIC, полипептид 19 CYP2C19 G681A 43 Цитохром P450, субсемейства IIC, полипептид 9 CYP2C9 C430T 44 Цитохром P450, субсемейства IID, полипептид 6 CYP2D6 del 2549A 45 Цитохром P450, субсемейства IID, полипептид 6 CYP2D6 C2850T 46 Глутатион-S-трансфераза М1 GSTM47 Глутатион-S-трансфераза T1 GSTT48 Глутатион-S-трансфераза Р1 GSTP A313G 49 Глутатион-S-трансфераза Р1 GSTP C341G 50 Коллаген тип I, альфа 1 COL1A1 G/T (intron1) 51 Коллаген тип I, альфа 1 COL1A1 G-1997T(promoter) 52 Эндотелиальный РАS домен белка 1 EPAS1A/G (intron1) 53 Инсулиноподобный фактор роста 2 IGF2 ApaI G17200A (3'-untrl.) 54 Инсулиноподобный фактор роста 2 IGF2 C13790G (intron1) 55 Интерлейкина-15 рецептор А ILK-15RA (exon7untranslated) 56 Ростовой фактор 8 GDF8 A/G (exon2) 57 Гормон роста 1 GH1 T/A (intron4) 58 Гормон роста 1 GH1 G/T (promoter) 59 Гормон роста 1 GH1 A/G (promoter) 60 Рецептор соматолиберина GHRHR G/A (exon3) 61 Гемоглобин HBB C/G (intron2) 62 Миоглобин MB A79G (exon2) 63 Синтаза оксида азота 3 NOS3 G894T (exon8) 64 Пероксисомный рецептор гамма PPARG C/G (exon2) 65 Титин TTN C/T (intron19) 66 Рецептор витамина D VDR (exon3) T/C 67 Фактор роста эндотелия сосудов A VEGFA A/C (promoter) 68 Аденозинмонофосфатдеаминаза AMPD C34T (exon2) 69 Креатинкиназа мышц CKM NcoI A/G (3'untransl.)







© 2011 www.dissers.ru - «Бесплатная электронная библиотека»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.