WWW.DISSERS.RU

БЕСПЛАТНАЯ ЭЛЕКТРОННАЯ БИБЛИОТЕКА

   Добро пожаловать!

На правах рукописи

ПОЗМОГОВА ГАЛИНА ЕВГЕНЬЕВНА

ИСКУССТВЕННЫЕ ДНК-СОДЕРЖАЩИЕ СУПРАМОЛЕКУЛЯРНЫЕ КОМПЛЕКСЫ

03.00.03. – молекулярная биология

АВТОРЕФЕРАТ

диссертации на соискание ученой степени доктора химических наук

Москва – 2008

Работа выполнена в центре "Биоинженерия" Российской академии наук и в Научноисследовательском институте физико-химической медицины "Росздрава"

Официальные оппоненты:

Доктор химических наук, профессор Елизавета Сергеевна Громова Доктор химических наук, чл.-корр. РАН Александр Габибович Габибов Доктор химических наук, профессор Юрий Михайлович Евдокимов

Ведущая организация:

Институт цитологии и генетики СО РАН

Защита состоится 2008 г. в на заседании диссертационного совета Д 002.235.01 при Институте молекулярной биологии им. В.А. Энгельгардта РАН по адресу: 119991, Москва, ул. Вавилова, д.32.

С диссертацией можно ознакомиться в библиотеке Института молекулярной биологии им. В.А. Энгельгардта РАН.

Автореферат разослан «__» _______________ 2008 г.

Ученый секретарь Диссертационного совета, кандидат химических наук А.М. Крицын

Общая характеристика работы

Актуальность работы. Одно из основополагающих природных свойств полинуклеотидов состоит в их способности ассоциироваться с различными биополимерами и низкомолекулярными соединениями с образованием функциональных супрамолекулярных комплексов. Надмолекулярные ассоциаты полинуклеотидов – естественная форма их существования. Конструирование искусственных комплексов ДНК и структурно-функциональное исследование таких модельных систем - продуктивный прием, как для изучения естественных природных процессов, так и для создания новых подходов к решению широкого спектра актуальных прикладных задач. В настоящей работе рассмотрены три группы супрамолекулярных ассоциатов ДНК. 1. Наиболее близкие природным аналогам нуклеопротеиновые транспортные комплексы для направленной доставки чужеродных олиго-/полинуклеотидов в целевые клетки живого организма. 2.

Комплексы, моделирующие свойства живой системы [живая клетка - фиксированная на внешней мембране ДНК - комплементарная нуклеотидная последовательность]. 3.

Искусственные ассоциаты ДНК и нуклеопротеиновые ансамбли с наночастицами металла (никеля).

Необходимость применения специальных транспортных систем для доставки чужеродного генетического материала в клетки-мишени остается существенным препятствием на пути развития генотерапии. Наибольшая избирательность в отношении целевых клеток показана для белковых переносчиков чужеродного генетического материала, использующих естественные механизмы клеточного обмена. В настоящее время, несмотря на обнадеживающие лабораторные результаты, известные белковые векторы в силу различных причин не удовлетворяют требованиям клинического применения. Поэтому особенно актуальна разработка новых подходов к созданию белков-транспортеров ДНК, способных к самопроизвольной сборке с различными терапевтически значимыми молекулами олиго- и полинуклеотидов с образованием стабильных в биологических жидкостях функциональных надмолекулярных комплексов. Для этой цели необходимо изучение закономерностей образования и структурно-функциональных свойств таких нуклеопротеиновых ассоциатов. Полученные результаты могут стать основой для разработки новых универсальных и технологически доступных неиммуногенных белковых векторов, необходимых для создания различных лекарственных средств для генотерапии заболеваний различной этиологии.

Многие адгезивные манипуляции с живыми клетками основаны на бинарных лиганд-рецепторных взаимодействиях. Для направленной мультиаффинной иммобилизации клеток на твердом носителе недавно было предложено снабдить поверхность клеток фрагментами ДНК. Для этого проводили ковалентную конденсацию активированных олигонуклеотидов с олигосахаридами клеточной мембраны, модифицированными азидо-группами (Chandra, 2006), что и придавало клеткам искусственное сродство к комплементарным последовательностям ДНК.

Реализация этой привлекательной и перспективной идеи осложнена и ограничена необходимостью использования небезопасных абиогенных интермедиатов и длительностью (трое суток) процедуры ДНК-модификации клеток. Создание нового способа быстрой, эффективной и безопасной для жизнеспособности клеток ассоциации ДНК с плазматической мембраной чрезвычайно актуально для развития новых подходов в инженерии тканей, получения искусственных межклеточных ассоциатов, разработки новых биосенсорных систем.

Одно из направлений в нанотехнологии состоит в получении новых материалов с использованием фрагментов ДНК, ковалентно связанных с наноразмерным носителем, например, частицами золота (Crocker, 2008). Наночастицы никеля, в сравнении с ранее описанными платформами, обладают рядом привлекательных свойств, обусловленных их электропроводными и магнитными характеристиками, а также уникальной способностью удерживать гистидинилированные белки (Becerril, 2006, Лазарев, 2007). Поэтому создание биосенсоров и диагностических систем на основе подобных биополимерных структур представляет значительный интерес.

Однако, закономерности процессов сборки ассоциатов наночастиц никеля с олигонуклеотидами и белками до сих пор не изучены. Непосредственная же металлизация ДНК путем восстановления катионов никеля приводит к изменению конформации и потере природных свойств полинуклеотида (Becerril, 2005, 2006).

Особенно важно в этой связи изучить условия образования комплексов и подтвердить целостность и функциональность молекул в их составе.

В настоящей работе большое внимание уделено исследованию, разработке и оптимизации методов синтеза фрагментов ДНК, в том числе содержащих модификации сахаро-фосфатного остова и различные заместители, способов получения рекомбинантных белков, а также подходов к формированию и анализу структуры комплексов полинуклеотидов.

Цели и задачи исследования. Цель настоящей работы состоит в конструировании искусственных ДНК-содержащих супрамолекулярных комплексов, изучении на этих моделях закономерностей их сборки и структурно-функциональных свойств и применении найденных подходов для решения важных прикладных медикобиологических и нанобиотехнологических задач, таких как:

конструирование новых белков-векторов, самоассоциирующихся с олигонуклеотидами и их аналогами, а также с плазмидной ДНК для избирательной доставки чужеродного генетического материала в целевые клетки;

создание нового способа быстрой, эффективной и безопасной для жизнеспособности клеток фиксации ДНК на внешней мембране клетки для расширения возможностей адгезивных манипуляций с живыми клетками;

получение функциональных ассоциатов олигонуклеотидов, белков и нуклеопротеиновых комплексов на основе наночастиц никеля;

разработка и оптимизация методов получения ДНК и белковых компонентов комплексов, а также способов формирования и анализа структурной организации супрамолекулярных ассоциатов полинуклеотидов.

Научная новизна и практическая значимость. Получены ковалентные белокбелковые и ДНК-белковые конъюгаты с применением природных [эпидермального фактора роста человека (ЭФРч) и альфа-фетопротеина] и новых рекомбинантных белков. Показано, что синтезированные соединения и комплексы способны избирательно интернализоваться целевыми клетками по рецептор-опосредованному механизму и обеспечивать доставку нуклеиновой компоненты к внутриклеточным мишеням. В качестве основы для конструирования переносчика биотинилированных молекул получен слитый функциональный белок - стрептавидин-дифтерийный токсин. На основании полученного экспериментального материала сформулирован новый подход к созданию транспортных белков для доставки чужеродной ДНК в клетки-мишени, в соответствии с которым получен ряд новых полипептидов, в том числе белок PGEk, состоящий из адресующего ЭФРч домена и олигокатионной ДНКсвязывающей последовательности. На примере взаимодействия плазмидной ДНК и различных олигонуклеотидов с PGEk изучены процессы формирования и свойства образующихся комплексов. Исследовано влияние конформации ДНК на строение и свойства ассоциатов с PGEk и влияние комплексообразования на структуру самой ДНК. Определены стерические и термодинамические параметры связывания белка с олигонуклеотидами. Показана выраженная корреляция между структурой комплексов и их биологическими свойствами. Обнаружено, что PGEk не только способствует более интенсивной интернализации ДНК клетками-мишенями, но и защищает ее от деградации нуклеазами. Показано, что PGEk в результате существенно увеличивает противоопухолевый эффект известных антисмысловых олигонуклеотидов, создавая реальную перспективу разработки широкого спектра адресованных генотерапевтических средств. Найденные подходы и закономерности носят системный характер и необходимы для конструирования новых переносчиков ДНК, избирательных в отношении различных типов клеток.

Предложен новый способ иммобилизации фрагментов ДНК на внешней поверхности клеток для генерации искусственного сродства клеток к комплементарным олигонуклеотидным последовательностям. Показано, что жирнокислотные производные олигонуклеотидов при внесении в культуральную среду нековалентно и эффективно удерживаются на внешней мембране клеток, не изменяя их жизнеспособности. Иммобилизованные олигонуклеотиды сохраняют природную способность к гибридизационным взаимодействиям. Найденный метод ДНК-маркирования клеток перспективен для создания биосенсоров, разработки новых подходов в инженерии тканей, получения искусственных межклеточных ассоциатов.

В работе продемонстрирована принципиальная возможность и перспективность использования наночастиц никеля для формирования многофункциональных биополимерных структур, а также их преимущества в сравнении с другими наноразмерными основами. Показана способность агрегатов наночастиц никеля ассоциироваться с фрагментами однонитевых ДНК с образованием стабильных комплексов. На примере рекомбинантных гистидинилированных белков исследовано образование протеин-никелевых ассоциатов. Впервые показано, что в составе комплексов молекулы биополимеров не деградированы и могут частично или полностью сохранять функциональные свойства, что создает основу для их использования, например, в системах селекции аффинных к белкам аптамеров.

Полученные результаты вносят вклад в создание новых биополимер-никелевых наноструктур - исследовательских и диагностических инструментов в области молекулярной наноэлектроники, биологии и медицины.

Оптимизированные методы и технологические приемы получения олигонуклеотидов, их структурных аналогов и производных, а также способы очистки и анализа фрагментов ДНК широко используются в лабораторной практике. С их применением получены новые штаммы-продуценты белков (атриального натрийуретического фактора, кальцитонина, гормона роста, эпидермального фактора роста, цитохромов и др.), трансгенные вирусы (на основе Х-вируса картофеля) и растения (арабидопсис, табак и картофель), разработаны диагностикумы различных инфекционных заболеваний. С помощью синтезированных олигонуклеотидов проведена одна из первых отечественных работ по геномному секвенированию (геном Х-вируса картофеля), а также конформационные исследования ДНК - параллельных дуплексов, триплексов, квадруплексов. В настоящей работе предложен новый методический прием, позволяющий осуществлять одновременный автоматический синтез олигонуклеотидов, содержащих различное число тиофосфорильных межнуклеотидных связей. Этот метод важен для поиска новых олигонуклеотидных лекарственных средств и развития ДНК-диагностики. Описана малоизученная реакция превращения полигалогензамещенных флоуронов в соответствующие акридины действием водного аммиака, являющаяся побочной при получении флуоресцентно меченых олигонуклеотидов. Использование зондов, синтезированных и выделенных с учетом этого процесса, позволило увеличить чувствительность ряда диагностикумов на 15-20%.

Разработанные методы и технологические приемы внедрены в производство диагностических наборов для определения широкого ряда патогенов, используются в производстве ДНК-синтезаторов серии ASM-800 и конструировании нового 96канального синтезатора ASM-1000 (ООО "Биоссет", Россия, Новосибирск).

Вклад автора. Работа носит выраженный междисциплинарный характер. Основной вклад автора состоит в теоретическом обосновании гипотез, постановке задач, детальном планировании проведения экспериментов и анализе их результатов. Кроме того, непосредственно автором выполнено подавляющее число синтетических, хроматографических и аналитических работ.

Публикации и апробация работы. По теме диссертации автором опубликовано более 60 печатных работ, в том числе 2 патента, главы в научных сборниках, статьи, 31 из них в рецензируемых отечественных и международных журналах из списка ВАК.

Материалы, включенные в диссертацию, докладывались более чем на всероссийских и международных симпозиумах и конференциях, в том числе на Int.

Conf. "Fundamental & Applied Problems in Phytovirology", 14 Conversation: Biomolecular Stereodynamics. Albany. US, Int. Conf. "RNA as Therapeutic and Genomics Target" IV Russian-French Symp. "Supramolecular Systems in Chemistry and Biology", Conversation: Biomolecular Stereodynamics, Int. Conf. "Molecular Biology on the verge of the XXI Century: genome structure. Functional Analysis", 56th ASMS Conference on Mass Spectrometry и др.

Структура и объем диссертации. Диссертация состоит из следующих частей:

введение, обзор литературы, обсуждение результатов, материалы и методы исследования, выводы, список литературы и приложения, содержащего 4 акта о внедрении части результатов работы в производство. Диссертация изложена на 2страницах машинописного текста, включает 8 аблиц и 63 рисунка. Список литературы содержит 286 ссылок.

Основное содержание работы

1. ДНК-компонента комплексов. При проведении многофакторных исследований очень важны точно выбранные модельные соединения и биологические системы, позволяющие достоверно регистрировать эффекты и объективно их интерпретировать. Так, фосфодиэфирные олигонуклеотиды быстро расщепляются в биологических жидкостях, и, например, наблюдая за флуоресцентной меткой, нельзя однозначно утверждать, что она еще входит в состав молекул олигомеров и делать выводы об их транслокации. Устойчивые к биодеградации тиофосфорильные олигонуклеотиды, сохраняя гибридизационные свойства своих природных аналогов, могут иметь иную стерическую организацию и иные закономерности и параметры сборки комплексов. Исходя из этих соображений, в работе проводились параллельные исследования модифицированных и немодифицированных олигомеров. Только анализ совокупности экспериментов позволял сделать достаточно корректные и обоснованные выводы. Поэтому в настоящей работе рассмотрены некоторые особенности получения полностью и частично тиофосфорильных олигонуклеотидов, а также олигомеров, содержащих флуоресцентные метки.

1.1. Олигонуклеотиды, несущие тиофосфорильные модификации заданной локализации. Среди модификаций сахаро-фосфатного остова, повышающих устойчивость олигонуклеотидов к биодеградации, наиболее подробно известны особенности применения и метаболизм тиофосфорильных олигонуклеотидов, показана их перспективность использования в качестве антисмысловых последовательностей. В то же время известно, что тиофосфорильные олигонуклеотиды обладают системной токсичностью. В ряде случаев плодотворным оказалось введение лишь нескольких концевых замен в состав фосфодиэфирного олигомера (Лактионов 1999, Herbert 2002). Использование частично модифицированных олигомеров дает ряд преимуществ в генодиагностике и быстрой амплификации плазмидной ДНК (Di Giusto 2003). Особенно важно изучение влияния тиофосфорильных замен на конформацию олигонуклеотидов-аптамеров, биологическая активность которых зачастую непосредственно обусловлена их пространственной организацией. Проведение скрининговых и сравнительных исследований требует синтеза широкого набора частично модифицированных олигонуклеотидов, однако технологические приемы их параллельного автоматического синтеза не разработаны. Преимущества предложенных в настоящей работе подходов состоят в простоте совмещения или чередования фосфодиэфирного и тиофосфорильного циклов автоматических синтезаторов при использовании стандартных растворов и реактивов.

Автоматический синтез олигонуклеотидов осуществляли в традиционном реакционном цикле амидофосфитного синтеза олигонуклеотидов. В случае тиофосфорильных звеньев стадию окисления проводили до кепирования, чтобы снизить вероятность образования фосфодиэфирных примесей. Для превращения промежуточных фосфоротриэфиров в O,O,O-триэфиры тиофосфорной кислоты использовали стандартный раствор 3H-1,2-бензодитиол-3-он-1,1-диоксида в ацетонитриле.

Одновременная сборка полностью модифицированных олигонуклеотидов или последовательностей, сочетающих один фосфодиэфирный и один 3'- или 5'-концевой тиофосфорильный блоки, не вызывает технических или программных затруднений.

Чередование фосфотриэфирных и тиофосфотриэфирных межнуклеотидных связей в заданной последовательности, различной для синтезируемых параллельно олигомеров, требует иной организации реакционных Рис. 1. Масс-спектры тиофосфорильных аналогов L1, L11, P4 и P561011 олигонуклеотида ATRциклов. При введении в состав d(GGTTGGTGTGGTTGG). Число атомов серы (N) в олигомеров нескольких молекуле олигомера рассчитано с точностью до целых по формуле: N= [Mнайд.- Мрассч.]/16 (1), где тиофосфорильных блоков Mнайд. – молекулярная масса, найденная массспектрометрически; Мрассч. – расчетная (независимо от протяженности молекулярная масса соответствующего этих участков) рационально фосфодиэфирного олигомера, в данном случае масса ATR15 = 4726 Да; 16 – разница в атомных использовать чередование двух весах серы и кислорода.

методов, состоящих из стандартной комбинации подпрограмм для 3'-фосфодиэфирных звеньев и, отличающиеся порядком стадий кепирования и окисления, а также, соответственно, составом и линией подачи окислителя, - для 3'-тиофосфорильных. Введение большего числа модифицированных блоков также возможно в условиях параллельного синтеза, но требует более глубоких изменений протокола синтеза. Для каждого нуклеотидного звена создается по 2 отдельных программы, причем блоки кепирования и окисления прописываются в подпрограмме конденсации. Выходы стандартно деблокированных и очищенных олигомеров не отличались от выходов фосфодиэфирных олигомеров и не зависели от режима их сборки.

Проблема получения высокоочищенных частично тиомодифицированных олигонуклеотидов состоит еще и в том, что не представляется возможным проконтролировать полноту прохождения реакции сульфурирования в ходе синтеза, и очистка целевых соединений от фосфодиэфирных примесей не всегда эффективна.

Надежным методом для подтверждения состава частично модифицированных олигомеров стала MALDI TOF МС. Для получения достоверных спектров тиоаналогов ДНК была проведена оптимизация ряда параметров масс-спектрометрии (подготовка матрицы, условия нанесения образца и др.). Характерные примеры спектров, полученные в найденных условиях, приведены на рис. 1. Результаты расчетов по формуле (1) с высокой точностью подтверждают состав синтезированных последовательностей.

На примере синтеза ряда тиоаналогов олигонуклеотидов продемонстрирована эффективность найденных решений, которые делают доступными частично модифицированные олигонуклеотиды, что позволит широко применять их как молекулярно-биологические исследовательские инструменты и компоненты диагностикумов, а также для поиска новых эффективных олигонуклеотидных лекарственных средств.

1.2. Флуоресцентномеченные олигонуклеотиды. Флуоресцентномеченные олигонуклеотиды широко применяются в современных исследованиях. В настоящей работе флуоресцентные производные олигонуклеотидов позволили визуализировать процессы интернализации клетками искусственных нуклеопротеиновых комплексов, их внутриклеточную локализацию и др. Совершенствование надежных методов получения высокоочищенных меченых олигонуклеотидов особенно актуально в связи с созданием комплексных диагностических наборов, позволяющих одновременно анализировать содержание в пробе нескольких ДНК-мишеней (Probert 2004, Ram 2005). Особенности хроматографического поведения модифицированных олигонуклеотидов, затрудняющие их очистку, обусловлены рядом причин, одна из которых связана с их склонностью к внутри- и межмолекулярной агрегации.

Соотношение конформационых форм олигомера зависит от температурного режима хроматографии и зачастую различно для разбавленных и концентрированных растворов. Поэтому профили аналитических и препаративных хроматограмм могут содержать разные пики, а условия хроматографии, найденные в аналитическом варианте, оказываются неэффективными для препаративной очистки. При оптимизации ВЭЖХ методов очистки олигонуклеотидов фракции анализировали с помощью MALDI МS, UV-спектрофотометрии, электрофоретического анализа в ПААГ и сравнивали эффективность их работы в соответствующих условиях ПЦР в реальном времени. В большинстве случаев найденные режимы оказались удачными для обращено-фазовых С16 и С18 колонок. В то же время, для некоторых олигомеров, в особенности тиофосфорильных G-богатых, нам не удалось подобрать приемлемые условия ВЭЖХ-очистки только изменением температуры, состава буферных растворов и градиентов элюции. В этих случаях эффективным оказалось использование колонок с фазой С4.

Другая проблема при получении высокоочищенных флуоресцентномеченных олигонуклеотидов состоит в том, что некоторые метки при деблокировании могут подвергаться структурной деградации. В результате в реакционной смеси синтеза накапливаются олигонуклеотиды, совпадающие по последовательности с целевым зондом, но имеющие иные флуоресцентные свойства, что может искажать результаты исследований. Ранее, например, был показан процесс трансформации метки, созданной на основе флуоресцеинизотиоцианата (Dubey 1998), в составе которой фрагмент тиомочевины частично превращается в остаток мочевины или гуанидина.

В нашей практике нестабильные результаты ПЦР-анализов наиболее часто встречались при применении гексахлорфлуоресцеинсодержащих олигомеров (HEXолигонуклеотидов). При хроматографическом анализе оказалось, что во всех случаях постаммонолизные смеси содержали примесь, которая совпадала по электрофоретической подвижности в ПААГ с целевым соединением, практически не отличалась от него по данным масс-спектрометрии, но имела и иной длинноволновый максимум в УФ-спектре, и другие флуоресцентные свойства. ВЭЖХ-профиль постаммонолизной смеси синтеза декамера 5'-HEX-T10, несклонного к самоассоциации, также содержал два мажорных пика, "А"- HEX-T10 и "Б"- HEX-T(рис. 2). Только второе вещество обладало характерными для HEX-производных спектральными характеристиками. Соотношение "Б"/"А" зависело от условий аммонолиза, причем повторный аммонолиз очищенного "Б"-HEX-T10 приводил к накоплению "А"- HEX-T10, содержание которого росло при увеличении длительности и/или температуры обработки. MС-анализ модельного HEX-изопропилфосфата (ХИПФ), аммонолиз которого также приводил к накоплению двух продуктов ("А"- ХИПФ - "Б"- ХИПФ) показал, что спектр "Б"- ХИПФ (рис. 3) полностью соответствовал теоретическому мультиплету (IsoPro 3), а в спектре "А"- ХИПФ наблюдался регулярный сдвиг всех сигналов на -1 Да. Полученные данные, а также ЯМР-спектры (не приведены) модельных соединений, позволяют сделать вывод о том, что водный аммиак в мягких условиях (при 20-60С) взаимодействует с флоуроновой группировкой и превращает ее в соответствующий замещенный акридин (рис. 3). Обнаруженный процесс не противоречит химии гетероциклов (Эльдерфильд, 1954), но ранее он был описан для реакции флоуронов с аммиаком при 180 в течение нескольких суток.

ХИПФ ХИПФ Рис. 2. ВЭЖХ-профили постаммонолизных Рис. 3. Масс-спектры и схема превращения смесей HEX-T10. Указаны температурный HEX-изопропилфосфата ("Б"-ХИПФ) в режим и продолжительность аммонолиза, УФ- акридиновое производное "А"-ХИПФ (a) и флуоресцентные спектры эмиссии ex 4(показан более стабильный таутомер).

нм (b) олигонуклеотидов "A"-HEX-T10 и "Б"HEX-T10.

В результате, показано, что при получении любого HEX-содержащего олигонуклеотида при аммонолизе образуется побочный продукт, производное тетрахлордиоксиакридина, примесь которого для получения достоверных результатов дальнейших исследований необходимо тщательно отделять.

1.3. Конформационные исследования олигонуклеотидов. Биологическая значимость структурного полиморфизма ДНК в последние годы находит все большее подтверждение. Богатая гуаниновыми повторами ДНК, например, способна образовывать стабильные четырехцепочечные структуры, G-квадруплексы, структура которых стабилизируется водородными связями в G-квартетах и стэкинг-контактами между ними. Показано, что подобные структуры существуют in vivo в ядре клетки (Paeschke 2005, Simonsson 2001). Изменение структурной организации ДНК, как например, в промоторе гена С-myc, может привести к развитию канцерогенеза (Siddiqui-Jain 2002). Кроме того, биологическая активность некоторых олигонуклеотидов непосредственно связана с их конформацией (Smirnov 2000, Lee 2004). Представляется важным изучить влияние комплексообразования на исходную конформацию ДНК и структуру самого комплекса. Для того, чтобы выбрать модельные олигонуклеотиды, необходимо было провести структурные физикохимические исследования. Один из продуктивных подходов к установлению вторичной структуры олигомеров состоит в изучении изменения параметров флуоресценции интеркаляторов (в настоящей работе - этидий бромида, EtBr) в составе комплексов с ДНК (Борисова 1998). Метод поляризованной флуоресценции EtBr был использован для определения молярности структур, образованных из олигонуклеотида d(TTAGGG)4 (названного TMO), его частичных и полного тиоаналогов (TMOS2, TMOS4 и TMS), фосфодиэфирных олигомеров d(TTAGGG)3, d(GT)12 и d(AC)12. Исследования проводились совместно с ИМБ им. В.А.

Энгельгардта РАН. Поляризация флуоресценции молекул EtBr (PEt), адсорбированного на фрагменте ДНК, связана с гидродинамическим объемом макромолекулы (V) и ее временем вращательной релаксации () уравнением ПерренаВебера: =3(1/Po –1/3)/(1/P – 1/Po) = 3 V/kT, (2), справедливым для модели эллипсоида с малой асимметрией, где - длительность флуоресценции EtBr в комплексе с олигонуклеотидом; P – измеряемая поляризация, Po = 0,42 предельная величина степени поляризации флуоресценции EtBr в бесконечно вязкой среде (T/ 0), - вязкость растворителя; T – абсолютная температура, k - постоянная Больцмана, V – гидродинамический объем макромолекулы. Рассчитанные времена вращательной релаксации олигонуклеотидов, находятся в соответствии с их молекулярными массами и количеством нуклеотидов в одной цепи, что свидетельствует о сворачивании этих молекул в мономолекулярные образования (табл. 1).

Конформацию олигонуклеотидов изучали по спектрам кругового дихроизма (КД).

На рис. 4 представлены спектры КД олигонуклеотидов, зарегистрированные в широком интервале изменения температуры раствора. При 0 и 15 С спектры TMO TMOS2 и TMOS4 (рис. 4а, 4d), содержат положительную полосу с максимумом около 295 нм и отрицательную – около 265 нм, что соответствует спектру антипараллельного G-квадруплекса. Спектр d(TTAGGG)3 при 0 С содержит две положительные полосы с максимумами около 295 и 265 нм (рис. 4b), что свидетельствует о сворачивании олигонуклеотида в шпилечную структуру. Спектр тиофосфорильного олигонуклеотида TMS характеризуется слабо выраженной положительной полосой с максимумом около 278 нм (рис. 4с), характерной для денатурированной нити тиофосфорильной ДНК, у которой практически отсутствуют стэкинг-контакты между основаниями. Видно (рис. 4с), что повышение температуры раствора слабо влияет на спектр КД TMS и сильно на d(TTAGGG)3 и TMO.

Таблица 1. Времена вращательной релаксации () и масса олигонуклеотидов.

M M Олигонуклеотид Олигонуклеотид (нсек) (Да) (нсек) (Да) TMO : TMS (24 н.о.) 24 ± 3 79(мономер -24 н.о.) 25± 3 79d(GТ)12 (24 н.о.) 26 ± 3 79(димер ~ 48 н.о.) 40± 5 130Декадуплекс (20 н.о.) 21± 3 66d(TTAGGG)3 (18 н.о.) 21± 3 59На рис. 5a приведены кривые термического плавления G-квадруплекса, построенные с использованием изменений в спектре КД, наблюдаемых при повышении температуры раствора.

Изменение амплитуды КДспектра при длине волны 2нм отражает плавление квадруплексной структуры, так как в этом диапазоне не происходит заметного наложения от КД-спектра шпилечных структур, образующихся при плавлении квадруплекса, что имеет место в области 295 нм. С использованием кривой Рис. 4. Спектры КД: TMO (a), d(TTAGGG)3 (b), TMS (c), плавления (рис. 5a, [--]) при их изменения при повышении температуры раствора и (d) сравнение спектров КД (15 C ) олигомеров TMO и =274 нм были рассчитаны его тиоаналогов, содержащих по 2 - TMOS2 - или по 4 TMOS4 - тиомодификации в петлях.

термодинамические параметры G-квадруплекса, которые свидетельствуют об образовании стабильного мономолекулярного антипараллельного G-квадруплекса TMO. На рис. 5a, (--) приведена кривая плавления шпильки d(TTAGGG)3, построенная с использованием изменений в спектре КД, наблюдаемых в длине волны =295 нм. Для сравнения приведены кривые термического УФ-плавления олигонуклеотидов, регистрируемые по изменению поглощения при =260 нм: TMO, TMS, d(TTAGGG)3, d(GT)12 и d(AC)(рис. 5b). Кривая УФ-плавления TMO (- -) также характеризуется высокой температурой плавления Tm= 56±5 C. Кривая УФ-плавления d(TTAGGG)3 (рис. 5 b -) характеризуется более низкой Tm= 36±5C, чем у G-квадруплекса, что свидетельствует о меньшей стабильности вторичной структуры этого образца.

Кривые плавления d(GT)12, d(AC)12 и TMS (рис. 5b -+-, -X-, --) доказывают отсутствие стабильной вторичной структуры у этих образцов. На основании полученных данных о времени релаксации , анализа спектров КД и кривых термического плавления исследуемых олигонуклеотидов можно утверждать, что TMO образует термостабильный антипараллельный внутримолекулярный G-квадруплекс, d(TTAGGG)3 - шпильку, TMS, d(GT)12 и d(AC)12 находятся в виде неупорядоченных нитей. Для дальнейших исследований важно отметить, что введение флуоресцентной метки, 5'-(6)FAM, в состав олигонуклеотидов TMS и TMO не внесло заметных изменений в их термодинамические и Рис. 5. Кривые термического плавления олигонуклеотидов: (a) – структурные параметры.

построены по изменениям спектров КД: TMO (- -), 295 нм, TMO (- -), 274 нм; d(TTAGGG)3 (--), 295 нм и TMS (--) в Охарактеризованные 279 нм; (b) – нормированные кривые УФ-плавления олигонуклеотидов, 260 нм: TMO (- -), d(TTAGGG)3 (--), шпилечные, нитевые и TMS (--), d(GT)12 (-+-) и d(AC)12 (-X-).

квадруплексные олигомеры были использованы как модельные соединения в исследованиях структурной организации нуклеопротеиновых комплексов.

Для выяснения влияния на биологическую активность олигонуклеотидов их связывания с белковыми векторами в работе использовались хорошо изученные антисмысловые олигомеры к генам С-myc, Bcl-II и др. (Dias 2002, Manoharan 2002, Kurreck 2003, Wang 2004), действие которых вызывает апоптоз опухолевых клеток.

В качестве плазмидной ДНК для получения нуклеопротеиновых ассоциатов использовались стандартные коммерческие плазмиды (Clontech, США), содержащие под ядерным промотором ген репортерного флуоресцирующего белка (GFP).

Другая область применения синтетических олигомеров – химико-ферментативный синтез генетических конструкций для получения трансгенных организмов, в том числе продуцентов рекомбинантных белков, которые также использовались в настоящей работе для получения нуклеопротеиновых ассоциатов. Основные подходы в этой области хорошо известны и не требуют подробных описаний. Многие из найденных методических разработок и приемов получения олигонуклеотидов вошли в рутинную лабораторную практику. С применением оптимизированных методов синтеза олигомеров получены новые штаммы-продуценты белков, трансгенные вирусы, растения. Разработки в области олигонуклеотидного синтеза уже внедрены в производство медицинских диагностических наборов, используются в производстве и конструировании новых ДНК-синтезаторов (соответствующие акты о внедрении приведены в разделе "Приложение" диссертации).

2. Нуклеопротеиновые комплексы для доставки чужеродной ДНК в клеткимишени. Настойчивый поиск способов доставки в клетки чужеродного генетического материала связан со спецификой его применения в терапевтических целях.

Уникальные адресующие свойства показаны для белковых переносчиков ДНК, методы конструирования которых подробно проанализированы в литературном обзоре настоящей диссертации. Интерес к белковым векторам особенно возрос в связи с открытием новых перспективных свойств олигонуклеотидов (антисенсы, аптамеры, ДНК/РНК гибриды, siRNA и др.). Настоящая работа развивает подход к созданию самоорганизующихся белковонуклеиновых молекулярных ансамблей, способных избирательно интернализоваться клетками-мишенями и обеспечивать взаимодействие нуклеиновой компоненты с внутриклеточными мишенями.

Избирательность в отношении целевых клеток таких комплексов обеспечивается взаимодействием белковой компоненты с тканеспецифическими поверхностными рецепторами или рецепторами патогенеза клеток-мишеней, а интернализация – рецептор-опосредованным эндоцитозом. Прежде, чем определить требования к белкам-переносчикам ДНК и разработать их структуру, были получены и исследованы различные рецептор-опосредованные доставщики чужеродной ДНК в клетки, отличающиеся как составом доменов, так и способами их соединения.

2.1. Ковалентные нуклеопротеиновые конъюгаты. Один из известных подходов к избирательной доставке в клетки фрагментов полинуклеотидов состоит в создании их химических конъюгатов с белками-лигандами поверхностных рецепторов целевых клеток (Manoharan. 2002. Rajur 1997). Для конденсации с производными антисмысловых олигонуклеотидов в настоящей работе использовались альфафетопротеин человека (АФП) и рекомбинантный эпидермальный фактор роста человека (ЭФРч), рецепторы которых наиболее характерны для опухолевых клеток (Carpenter 1979, Ogiso 2002, Ницветов 2005). ЭФРч как вектор обладает рядом известных привлекательных сторон, кроме того, удаленность N-конца молекулы от рецептор-связывающего участка (Hommel 1992) облегчает получение модифицированных производных, потенциально сохраняющих аффинные свойства ЭФРч. Биотехнологическую наработку препаратов рекомбинантного рЭФРч (по данным ВЭЖХ 93-96%) осуществляли, используя полученный нами продуцент - S. cerevisiae BKM CR-349D.

По физико-химическим и иммунологическим характеристикам полученный препарат рЭФРч соответствует его природному аналогу. Метод конденсации предусматривал синтез антисмысловых олигонуклеотидов, снабженных 3’-концевым уридиновым звеном (I на рис. 6), цис-диольная группировка которого направленно расщеплялась периодатом натрия. Небольшой избыток (10%) обессоленных диальдегид-производных (II) взаимодействовал без дополнительного R = 5'-AATCCTCCCCCAGTTCACCC катализа и конденсирующих реагентов с ЭФРч = 5'-AACGTTGAGGGGCAT Рис. 6. Схема синтеза и ВЭЖХ анализ с образованием конъюгатов III. Ход реакции реакции получения конъюгата ЭФРч с контролировали методом ВЭЖХ (рис. 6), олигонуклеотидом R(CHO)2, R = 5'AATCCTCCCCCAGTTCACCC -Диасорб выходы конъюгатов составляли 78-91% на С16Т, 4х250 мм, градиент ацетонитрила в 0,1NH4OAc, поток - 0,исходный белок. Состав конъюгатов (белоко мл/мин, температура 30 С, детекция олигонуклеотид 1:1) определяли по УФ-детектор (), =260 нм, флуоресцентный детектор (---), ex=2соотношению поглощений при 260 и 280 нм, нм, em=380 нм.

данным MALDY TOF масс-спектрометрии и анализу состава кислотных гидролизатов полученных соединений. Можно предположить, что конденсация проходила преимущественно по N-концевой аминогруппе белка за счет образования амидиновой группировки, что не должно было нарушить рецептор-связывающие свойств ЭФРч в составе конъюгата. Важно отметить, что ЭФРч (Serva), рекомбинантный рЭФРч и конъюгаты ЭФРч-олигомер вызывали одинаковую индукцию стимуляции пролиферации клеток (данные по включению [3Н]-тимидина в ДНК синхронизированных мышиных фибробластов линии 3T3). В экспериментах с целевыми клетками линии КВ и рецептородефицитными контрольными – линии К562 (совместно с НИБОХ СО РАН) было показано, что конъюгаты ЭФРч-антисмысловой олигомер в 5-20 раз снижали относительное содержание мРНКмишени, причем только в Рис. 7. Схема синтеза ковалентных конъюгатов AFP с целевых клетках.

аминоалкильными производными олигонуклеотидов.

АФП, выделенный по известному методу (Wagner 1970) из ретроплацентарной сыворотки рожениц, после модификации конденсировали с активированными производными олигонуклеотидов в соответствии со схемой, приведенной на рис. 7. Содержание олигонуклеотида в конъюгате с АФП определяли по соотношению сигналов в УФспектре при 260 и 280 нм.

2.2. Получение белковых векторов химической конденсацией доменов.

Полилизиновый конъюгат природного АФП, который был синтезирован в настоящей работе, по принципам конструирования аналогичен искусственным полипептидам ЭФРч-полилизин, трансферин-полилизин, асиалогликопротеинполилизин и др. Представлялось интересным непосредственно, в условиях параллельных экспериментов, сравнить два типа доставки антисенс-олигомеров с помощью одного и того же адресующего домена (АФП): в виде комплексов [АФПполилизин – олигонуклеотид] и ковалентных конъюгатов АФП-олигонуклеотид.

С полилизином (М.в. 29,3 КДа) АФП А Б сшивали с помощью бифункционального реагента SPDP (V). Конъюгат АФПполилизин выделяли на колонке Superdex Рис. 8. Распределение флуоресценции в 200 HR ионообменной хроматографией.

клетках MCF-7 после 24 часа инкубации с ковалентным конъюгатом 5’-FAMПри электрофорезе в восстанавливающих AACGTTGAGGGGCAT-АФП. А)условиях фракций, содержащих конъюгат, флуоресцентная микроскопия, Б) - те же клетки в фазовом контрасте.

появлялась полоса, соответствующая по молекулярному весу АФП.

Исследование накопления клетками конъюгата и комплекса АФП с флуоресцентномеченными олигонуклеотидами проводили с помощью метода проточной цитофлуориметрии. Показано, что как комплекс, так и конъюгат активно захватываются опухолевыми клетками SKOV3 и MCF-7, причем интенсивность эндоцитоза конъюгата значительно (в 5-6 раз) выше, чем комплекса. Вероятно, химическое присоединение молекул полилизина к АФП может влиять на доступность рецептор-связывающего участка АФП.

Флуоресцентная микроскопия клеток MCF-7, инкубированных в присутствии и конъюгата АФП-олигомер-FAM (FAM – флуоресцентная метка), и комплекса АФПполилизин-олигомер-F показала, что уже через 1 час флуоресценция наблюдалась в перинуклеарной зоне клетки, в областях эндо-плапзматического ретикулума и комплекса Гольджи (рис. 8).

2.3. Рекомбинантные белковые векторы-переносчики полинуклеотидов.

Наиболее перспективный, гибкий и доступный способ получения новых белков сегодня - это химико-ферментативный синтез гена, получение штамма-продуцента и биотехнологическая наработка рекомбинантного полипептида.

Среди рецептор-опосредованных белковых доставщиков в клетки различных веществ, в том числе чужеродной ДНК и цитостатиков, заметное место занимают рекомбинантные мультидоменные белки, созданные на основе токсинов (Liao 1995, Uherek 1998, Spano 2008, Rhie 2008, Epaulard 2008 и др.).

Оригинальность белковой конструкции, полученной в настоящей работе (совместно с ГНЦ Прикладной микробиологии), состоит в том, что в качестве связывающего домена белок содержит остаток стрептавидина, который обеспечивает его избирательное взаимодействие с биотинилированными молекулами, в том числе ДНК. Гибридный полипептид дифтерийный токсин-стрептавидин (72366 Да), состоит из 511 аминокислотных остатков дифтерийного токсина и зрелой формы стрептавидина. Его ген содержит 2016 п.н., которые кодируют 672 аминокислотных остатка: 511 N-концевых аминокислот дифтерийного токсина, один остаток, образовавшийся в результате слияния генов (глицин), метионин, введенный в ген стрептавидина в результате ПЦР и 159 С-концевых остатков зрелого стрептавидина.

Индукция промотора фага Т7 в клетках полученного штамма-продуцента Е. соli BL21(DE3)p LysS, приводила к синтезу гибридного белка размером около 72 кДа,, что соответствует значению вычисленной молекулярной массы слитого белка (72366 Да).

Гибридный белок обладает ферментативной активностью дифтерийного токсина и сохраняет способность стрептавидина связывать биотин, подобно стрептавидину в составе других гибридных белков (Karp 1996). Иммуноблот слитого белка, перенесенного на нитроцеллюлозный фильтр из ПААГ, обладал биотинсвязывающей активностью и антигенными свойствами дифтерийного токсина. Далее планировалось заменять каталитическую субъединицу токсина остатками адресующих белков-лигандов и получить рекомбинантные векторы, способные переносить в целевые клетки биотинилированные молекулы.

Однако анализ экспериментальных и литературных данных показал, что, несмотря на убедительные результаты по селективной доставке чужеродного генетического материала с помощью различных белковых векторов и адресованных конъюгатов ДНК in vitro, их клиническое использование сталкивается с рядом проблем. Низкая растворимость и неприемлемые геометрические размеры ДНК-векторных ассоциатов, а также общая цитотоксичность поликатионов остаются основными причинами, тормозящими практическое применение полиплексных векторов. Кроме того, химическое соединение доменов может приводить к искажению аффинных свойств адресующего лиганда, как, например, описано выше для вектора АФП-полилизин.

Использование рекомбинантных мультидоменных конструкций решает проблему наработки гомогенных по составу препаратов белка, но их использование ограничено иммуногенностью чужеродных белков и их ассоциатов. Последнее замечание стало решающим аргументом для отказа от продолжения работ по созданию аналогичных конструкций на основе полученного белка дифтерийный токсин-стрептавидин.

Из анализа приведенных данных можно предположить, что определяющими для реализации функциональных задач являются свойства ассоциатов, а не их компонентов. Следовательно, при разработке структуры транспортных белков необходимо, в первую очередь, прогнозировать свойства их нуклеотидных комплексов и взаимодействия этих ансамблей с биополимерами, которые также ассоциированы с внутриклеточными молекулярными структурами. В основе настоящего подхода лежит представление о том, что транспортный белок должен самопроизвольно ассоциироваться с генетическим материалом с образованием стабильного в физиологических условиях, низкоиммуногенного комплекса, избирательного в отношении клеток-мишеней. При разработке структуры векторов были соблюдены следующие важные требования. 1). Максимально упростить конструкцию белка за счет многофункциональности его двух доменов. 2).

Использовать минимальные по размерам и максимально охарактеризованные участки гидрофобного и гидрофильного доменов. 3). Внести минимальные изменения в природные последовательности. 4). Предусмотреть возможность внутриклеточного расщепления комплекса с образованием нетоксичных метаболитов. 5). Обеспечить универсальность белка по отношению к природе и длине генетического материала. 6).

Предусмотреть как технологическую доступность получения, так и удобство использования белка-вектора.

2.3.1. Белковый вектор PGEk. При конструировании на основании изложенных принципов рекомбинантных белков-векторов для доставки олигонуклеотидов в активно пролиферирующие клетки в качестве рецептор-связывающего домена был выбран ЭФРч. ДНК–связывающий домен представлен последовательностью, содержащей классический мотив того сигнала ядерной локализации (NLS), который способен сохранять кариофильность в составе комплексов с ДНК (Collas 1997, Uherek 2000). Эксперименты с ковалентными конъюгатами ЭФРч показали, что N-концевая модификация этого белка не препятствует лиганд-рецепторным взаимодействиям (см.

выше), что послужило основанием для выбора структуры вектора, названного PGEk.

PGEk состоит из 64 аминокислотных остатков, 11 из которых соответствует мотиву NLS (подчеркнут), слитых с последовательностью ЭФРч:

KKKKRKVEDPYNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQY RDLKWWELR.

Для получения белка PGEk был создан экспрессионный вектор, несущий ген слитого белка тиоредоксин - ЭФРч. Введение с помощью метода ПЦР точечных мутаций в ген тиоредоксина (Glu30His и Gln62His) позволило выделять слитый белок металлохелат аффинной хроматографией, а введение С-линкера (Link = (Asp)4-Lys) – гидролизовать полипептид энтерокиназой.

Экспрессионный вектор Trx-Link-PGEk получали введением в состав плазмиды фрагмента, кодирующего участок связывания генетического материала, используя синтетические олигонуклеотиды. Продуцент слитого белка Trx-Link-PGEk (В-8389 ВКПМ) получали трансформацией этой Рис. 10. Электрофоретический анализ стадий плазмидой клеток штамма получения и очистки белков ЭФР и PGEk (трицинПААГ,15%). 1 - очищенный PGEk; 2 - гибрид E. coli BL21(DE3)pLysS.

тиоредоксин- Link-PGEk после гидролиза EKL; 3. Слитые белки выделяли из гибрид тиоредоксин (Trx)- Link-PGEk; 4 -. очищенный ЭФРч; 5 - гибрид тиоредоксин -ЭФРч после гидролиза дезинтегрированных клеток EKL штамма-продуцента хроматографией, затем обессоленный полипептид обрабатывали энтерокиназой EKmax (“Invitrogen”). PGEk из гидролизата очищали ситовой и ионообменной хроматографией. Электрофоретический контроль стадий получения PGEk и ЭФРч приведены на рис. 10. Чистота препаратов PGEk (7622 Да) по данным обращено-фазовой ВЭЖХ составляла не менее 97%. Аналогично был получен белок PGEkR, укороченный на 5 С-концевых аминокислотных остатков гомолог PGEk.

PGEk-опосредованная доставка чужеродной ДНК в целевые клетки. Для того чтобы изучить транспортные свойства белков PGEk и PGEkR, в первую очередь были проведены их испытания in vitro. Цитологические работы (cовместно с НИБОХ СО РАН и Московским НИИ медицинской экологии) проводились на линиях клеток, для которых показана экспрессия ЭФРч-рецепторов: HeLa, MCF-7, А431, КВ, B-клеточная лимфома Namalva и SCOV3. В качестве отрицательного контроля использовали дефицитные по EGF-рецепторам клетки линии К562. Как положительный контроль рассматривали результаты доставки тех же генетических конструкций в клетки липофекцией. Уже первые исследования транспортных свойств белка PGEk свидетельствовали о его эффективности. Как видно по данным в табл. 2, присутствие белка в 3-5 раз увеличивало интенсивность флуоресценции целевых клеток А431 в сравнении с клетками, инкубированными только c FAM-олигомером. Для контрольных клеток присутствие PGEk приводило к относительному снижению этого Таблица 2. Влияние вектора PGEk на доставку показателя на 10-20%. Таким тиофосфорильного 5’-FAM-олигонуклеотида F2009 в образом, использование PGEk клетки линии А431 и K562.

для доставки олигонуклеотидов уменьшало вероятность их попадания в нецелевые клетки.

Присутствие PGEk не только 0 3,83 0,способствовало избирательному F2009 17,2 97,поглощению олигонуклеотидов, А431 PGEk:F2009 3:1 47,1 99,8 3,но и усиливало их исходные PGEk:F2009 5:1 64,4 99,9 4,противоопухолевые свойства.

PGEk:F2009 10:1 73,6 100 5,Так, в отношении клеток линии 0 5,07 0,В показатель выживаемости - K562 F2009 54,4 96,IC50 - при действии PGEk:F2009 10:1 47,9 95,7 0,тиофосфорильных антисмысловых олигомеров AS1 (к гену C-myc) и 2009 (к гену bcl2) составлял ~ 2000 нМ, а в комплексе с белком –630 нМ (однократное добавление) и нМ (двукратное добавление) соответственно.

Сравнение митогенной активности PGEk и его смесей с олигонуклеотидами ТМО, TMS и плазмидной ДНК (pEGFP N1) с активностью ЭФРч не выявило разницы между белками. Активность PGEk в составе ассоциатов с олигонуклеотидами, видимо, зависела от содержания PGEk в комплексе и пропорционально снижалась в интервале величины молярных избытков белка 1-5 для ТМО, 1-3 для TMS и 1-25 для плазмиды.

Полученные зависимости подтверждают специфичность связывания комплексов с Рис. 11. Накопление FTMO, FTMS и их рецептором ЭФРч и позволяют комплексов с PGEk клетками SKOV3 за 1 ч инкубации при 37оС. Данные предположить, что с рецептором связывается проточной цитометрии.

только один остаток ЭФРч.

Результаты исследования уровня эндоцитоза целевыми клетками после 1 часа инкубации со свободными FTMO и FTMS и с их смесями с PGEk (рис. 11) свидетельствуют о том, что присутствие даже 1 молекулы белка значительно (в 3-раз) повышало флуоресценцию клеток. Увеличение избытка белка не приводило к росту эффективности транспорта олигомеров.

М\М F20Линия клеток Относит.

клеток, % Флуоресц.

Добавлено Ср. интенс.

флуоресц. к Соотношен.

флуоресц., У.Е Через 24 часа картина для FTMS не изменилась (рис.12 Ж-К), а в случае ТМО флуоресценция сохранялась только в клетках, обработанных олигомером с 4-5 кратным избытком PGEk (рис. 12. Г, Д), т.е. накопление клетками SKOV3 флуоресцентномеченных олигонуклеотидов после более продолжительной, 24-часовой инкубации, уже существенно зависело и от содержания PGEk в комплексах, и от природы олигонуклеотида.

Видимо, образование комплекса с 4-молекулами белка защитило фосфодиэфирный ТМО от деградации. На микрофотографиях видно, что доставка в составе комплексов с Рис. 12. Флуоресценция FTMO и PGEk не препятствовала внутриклеточному FTMS в клетках SKOV3 после 24 ч трафику олигонуклеотидов в ядро (рис. 13.).

инкубации со свободными олигонуклеотидами и в составе Известно, что TMO и TMS ингибируют комплексов с PGEk. А-Д – FТМО, Е-К – FTMS. А, Е – FTMO и FTMS, Б, Ж – активность теломеразы (Sun 1997, Wang 2004).

соотношение PGEk/олигонуклеотид TMS в микромолярных концентрациях 1/1; В, З – 2/1, Г, И – 4/1, Д, К – 5/1.

обладает неизбирательной цитотоксичностью, а для TMO цитотоксическая активность не обнаружена. В настоящей работе показано, что инкубация клеток линии HeLa (2х1рецепторов/клетку, Berkers 1991) с комплексом PGEk/TMS в течение 5 суток приводила к их гибели в 10 раз эффективнее, Рис. 13. Распределение чем от свободного TMS. Для клеток линии флуоресценции в клетках SKOVпосле 24 ч инкубации с MCF-7 (3х103 рецепторов/клетку Kroning 1995) комплексом PGEk/ FTMS. слева – значение IC50 для комплекса PGEk/TMS было зеленая FTMS, справа – голубая флуоресценция Hoechst 333в 2 раза выше (около 500 нМ). Примечательно, (ядра клеток).

что практически таким же антипролиферативным действием обладал комплекс PGEk/TMO (5:1). Этот факт впервые создает реальную перспективу эффективного генотерапевтического применения нетоксичных фосфодиэфирных фрагментов ДНК.

Влияние вектора PGEk на доставку плазмиды в опухолевые клетки.

Эффективность доставки плазмиды липофекцией, судя по экспрессии репортерного белка GFP, оказалась одинаковой для клеток всех рассмотренных культур (табл. 3).

Присутствие PGEk приводило к флуоресценции только целевых клеток (HeLa и А431, см. табл. 3 и рис. 14), причем в узком интервале соотношений. Характерно, что максимум эффективности, хотя Контроль: клетки A431 Клетки A431+плазмида и различался по амплитуде, но + плазмида pEGFP-N1 pEGFP-N1: PGEk, 1:совпадал по молярным избыткам белка (PGEk/ДНК, 25/1), что соответствует и составу комплекса с минимальной удельной Рис. 14. Влияние вектора PGEk на доставку репортерной плазмиды pEGFP-N1 в опухолевые клетки линии А431.

митогенной активностью.

Дальнейшее увеличение избытка белка подавляло эндоцитоз комплекса, очевидно, вследствие конкурентного связывания свободных молекул PGEk с рецепторами ЭФРч.

Таблица 3. Влияние PGEk на доставку репортерной плазмиды в опухолевые клетки.

Добавлено Соотношение Флуоресцирующих. клеток, % (ДНК = плазмида Культура клеток pEGFP N1) M/М HeLa А431 K5ДНК/липофектин 85-90 85-95 85-ДНК 0 0 ДНК:PGEk 1:1 0 0 ДНК:PGEk 1:8 20 – 30 25-35 ДНК:PGEk 1:16 20 – 30 40-45 ДНК:PGEk 1:25 40 – 46 50-56 ДНК:PGEk 1:32 20 – 30 40-45 ДНК:PGEk 1:64 – 5000 0 0 2.3.2. Сборка и структурная организация комплексов PGEk –ДНК. Для изучения структурной организации PGEk-ДНК комплексов использовались флуоресцентные методы в сочетании с методами кругового дихроизма и УФ-плавления, позволяющие получать данные в условиях максимально приближенных к физиологическим (совместно с ИМБ им. В.А. Энгельгардта РАН). Влияние различных конформаций олигонуклеотидов на ассоциацию с молекулами PGEk и состав комплексов исследовалось с применением охарактеризованных выше модельных олигомеров.

Подвижность молекул РGEk в комплексе с ДНК оценивали по изменению времени вращательной релаксации () свободных молекул ДНК и PGEk-ДНК комплексов.

Сравнение экспериментальной (1 на рис.15) и теоретической (2 на рис. 15) зависимостей позволяет сделать вывод о том, что жестко с белком связаны ~ 10-аминокислот РGEk (~соответствующие NLS-домену), а ЭФРч домен способен вращаться относительно молекулы ДНК.

Полученные данные о динамике PGEk в составе комплекса с ДНК важны для понимания механизмов переноса комплексов через мембрану клетки и взаимодействия ассоциатов PGEk с ЭФРч-рецепторами.

Изучение комплексов PGEk-ДНК с помощью собственной УФ-флуоресценции белка, обусловленного остатками триптофана Рис. 15. Относительное увеличение времени релаксации PGEk-ДНК (возб.=284 нм, флуор. =341 нм), позволило комплекса в зависимости от выявить разницу в зависимостях изменений количества адсорбированных на ДНК молекул белка (r). 1 рассчитана интенсивности (I) и поляризации (P) УФтеоретически для жeстко связанного белка на ДНК, 2 – экспериментальные флуоресценции PGEk при титровании белком данные.

олигомеров, имеющих форму нити, шпильки или квадруплекса и построить соответствующие изотермы адсорбции (рис.16).

Как видно на рис. 16, адсорбция молекул PGEk на всех олигонуклеотидах в интервале 2 r 3 хорошо описывается с помощью некооперативного механизма связывания, для которого справедливо уравнение:, где Кass – константа ассоциации, С2 и С1 – концентрация связанных и свободных молекул PGEk. CDNA - молярная концентрация олигонуклеотида, выраженная в цепях, N – максимальное число мест связывания молекул белка на олигонуклеотиде. При кооперативном механизме связывания молекул PGEk использовали уравнение Хилла:

, где - коэффициент кооперативности Хилла. Пересечение начального наклона кривой с осью абсцисс (рис. 16) позволяет определить количество сильных мест связывания (N1 = 3). Численное значение тангенса угла наклона кривой равно константе ассоциации (К1). Константы связывания сильного типа комплекса Кдля всех олигонуклеотидов оказались близкими 107 М-1. Константа связывания PGEk на G-квадруплексе, К1= (2.0±0.4)107 М-1, оказалась самой высокой по сравнению с другими олигонуклеотидами (табл. 4) с коэффициентом кооперативности Хилла = 4. Последующая сорбция молекул PGEk на ТМО и TMS происходит по кооперативному механизму с более низкими величинами констант ассоциации.

Рис. 16. Изотермы адсорбции молекул PGEk на олигонуклеотидах. (a) - TMO (- -) и TMS (--);

(b) - d(TTAGGG)3 (--); (c) - d(GT)12 (-+-) и d(AC)12 (-X-)., r – количество связанных молекул белка, приходящихся на олигонуклеотид; С1 – концентрация свободного белка в растворе, o выраженная в мкМ. Измерения сделаны в PBS-буфере при 30 C.

Таблица 4. Параметры связывания PGEk на олигонуклеотидах в PBS-буфере при 3 и 37 0С.

Kass, r -G, Kass, r Олигонуклеотиды 10 6 M-1 кДж моль-1 10 6M- 3 0С 3 0С 37 0С 37 0С G-квадруплекс, TMO 20 ± 4 3 39 ± 7 70 ± 10 < 3.0 ± 0.2 3 r 6 34 ± 2 4.0 ± 1.5 3 r Шпилька, 18 ± 5 3 38 ± d(TTAGGG)3 1.9 ± 0.3 3 r 5 33 ± Нить, 17 ± 4 3 38 ± 8 30 ± 5 < TMS 1.5 ± 0.4 3 r 6 32 ± 8 0.8 ± 0.2 2 r Нить, 8.0 ± 3 3 36 ± d(GT)12 1.7 ± 0.3 3 r 5 33 ± Нить, 10 ± 3 3 37 ± d(AC)12 1.7 ± 0.3 3 r 5 33 ± Наблюдаемое сильное кооперативное связывание молекул PGEk на G-квадруплексе и его отсутствие на других олигонуклеотидах объясняется существенным различием в конформациях исследуемых образцов. На основании анализа спектров КД (рис.17) было установлено, что в составе ассоциатов с PGEk молекулы TMO свернуты в антипараллельный G-квадруплекс. Молекулы TMS, d(GT)12 и d(AC)12 не имеют выраженной вторичной структуры и находятся в виде неупорядоченных нитей.

Молекулы d(TTAGGG)3 сохраняют конформацию шпильки (не приведены). В то же время по мере добавления белка наблюдается падение амплитуды спектра около 290295 нм и смещение максимума к 300 нм. КД спектры белка в этой области не вносят изменения в интенсивность сигналов.

Линейная зависимость падения амплитуды около 290 нм от количества связанных молекул PGEk (PGEkR) r (рис. 18) позволяет предположить, что адсорбция каждой молекулы вызывает некоторое изменение его конформации, b частичное раскручивание четырехцепочечной спирали. Однако, даже при максимальном насыщении комплекса PGEk /ТМО, 5/1 сохраняется исходная конформация олигомера.

Суммируя экспериментальные Рис. 17. Спектры КД: комплексов PGEk: ТМО.

данные, можно достаточно Соотношение PGEk/ДНК увеличивали: 1- 0; 2 1,7; 3 - 2,6; 4 - 3,4; 5 - 5,1(а); для комплексов аргументировано описать процессы PGEk: TMS. PGEk/ДНК= 0(–), 2,3(- -)(b).

формирования и структурнофункцональные свойства нуклеопротеиновых супрамолекулярных ансамблей ДНК с рассматриваемыми белками. Так, самопроизвольная ассоциация белков PGEk или PGEkR с олигонуклеотидами различного состава и длины, а также с их тиофосфорильными аналогами в физиологических условиях происходит о быстро (даже при 3 С ~ за 2 мин), не требуя никаких дополнительных манипуляций.

Достаточно присоединения 1 молекулы белка, чтобы обеспечить избирательную интернализацию олигонуклеотидов клеткамимишенями (см. табл. 2, рис. 11, 12).

При увеличении избытка белка происходит достройка ассоциатов до насыщения (средняя Рис. 18. Изменение амплитуды спектра КД около 290 нм для молекул ТМО константа диссоциации Кд = 10-7 М), причем при увеличении адсорбированных их состав определяется не только длиной (молекул PGEk (PGEkR), приходящихся на олигонуклеотид (r).

белок /~ 6-7 звеньев денатурированной олигонуклеотидной цепи), но в большой степени и конформацией ДНК. Так, 24-мер в виде нити способен связать 3 молекулы, а 24-мерный G-квадруплекс - 5-6 молекул белка (см. рис. 16 а).

Из результатов исследований, проведенных на примерах олигонуклеотидов в виде денатурированной нити, шпильки и квадруплекса следует, что основные параметры исходной стерической организации олигонуклеотида сохраняются и в составе ассоциатов (рис.17).

Механизм образования комплексов для олигомеров в виде нити и дуплекса носит некооперативный характер, в случае квадруплекса ТМО первые 2-3 молекулы белка также связываются некооперативно, а следующие 2-3 молекулы присоединяются по кооперативному механизму, слегка раскручивая жесткую исходную структуру олигонуклеотид (табл. 4, рис. 18).

Интернализация транспортных комплексов происходит по механизму рецепторопосредованного эндоцитоза, что и обеспечивает избирательность доставки ДНК в клетки-мишени (табл. 2, 3).

В составе ассоциатов наблюдается гибкое связывание ЭФРч-домена, что позволяет его А-петле легко подстраиваться под структуру ЭФРч-рецепторов (рис. 15).

Все рассмотренные нуклеопротеиновые комплексы являются одним модифицированным ЭФРч-лигандом (данные о пропорциональном снижении пролиферативной активности комплексов см. на стр 21). Другими словами, во взаимодействии с целевым ЭФРч-рецептором участвует только один остаток ЭФРч из всего ассоциата, вне зависимости от его состава. Этот факт, а также некооперативное присоединение первых молекул белка к ДНК (табл. 4), создает основу для конструирования адресованных комплексов ДНК, содержащих наряду с молекулами векторов дополнительные молекулы, придающие супрамолекулярным ассоциатам новые свойства.

Присутствие белков-векторов снижает вероятность попадания чужеродной ДНК в нецелевые клетки (табл. 2).

Комплексообразование с белками PGEk или PGEkR усиливает или даже генерирует биологическое действие ДНК-компоненты, причем только в отношении целевых клеток (см. стр. 22-23).

Полученные данные позволяют предположить, что ассоциаты ДНК с PGEk или PGEkR способны к NLS-опосредованной ядерной транслокации (рис. 13).

Если рассматривать ассоциаты ДНК-PGEk как X-ЭФРч лиганды, сохраняющие связь с рецептором в эндосоме, то теоретически можно представить, что ДНК способна оказаться в ядре либо при растворении ядерной оболочки во время митоза, либо в результате развития одного из трех не исключающих друг друга процессов.

1). Высвободиться в цитозоле и пассивно диффундировать в ядро, минуя ядерный поровый комплекс. Это вполне возможно для тиофосфорильных олигонуклеотидов, но противоречит данным об активности биодеградируемых фосфодиэфиров.

2). Попасть в ядро в составе комплекса [ДНК-белок-рецептор]. Этот вариант кажется маловероятным, поскольку противоречит данным об успешной доставке антисмысловых олигомеров к внеядерным РНК-мишеням.

3). Более вероятным представляется высвобождение в цитоплазме не ДНК, а ее комплекса с PGEk. Это объясняет и защиту от нуклеаз, поскольку все фосфаты остаются экранированными, и активный NLS-обусловленный транспорт в ядро, и возможность перехвата ДНК-составляющей комплекса аффинной молекулярной мишенью еще в эндоплазматическом ретикулуме.

Полученные белки PGEk или PGEkR перспективны для создания высокоэффективных адресованных генотерапетичских средств и их применения, поскольку каждый из них характеризуется следующими необходимыми свойствами.

Универсальность по отношению к длине, составу и конформации ДНК.

Избирательность и эффективность доставки генетического материала.

Увеличение активности олигонуклеотидов и ДНК.

Защита ДНК от деградации.

Технологическая доступность и удобство в использовании.

Найденные в результате реализации нового подхода к конструированию белковпереносчиков ДНК в целевые клетки закономерности имеют системный характер и необходимы для понимания молекулярных механизмов действия природных и искусственных нуклеопротеиновых комплексов и конструирования новых переносчиков ДНК.

3. Искусственные ДНК-ассоциаты, содержащие живые клетки. Интересная и перспективная задача по разработке направленных методов создания ассоциатов, содержащих живые клетки, может быть решена на основе использования свойств полинуклеотидов, предварительно зафиксированных на внешней мембране клеток.

Ключевую роль при создании таких модифицированных мультиаффинных ДНКмеченых клеток играет способ фиксации ДНК. В настоящей работе предложен новый метода иммобилизации олигонуклеотидов на внешней мембране живой клетки за счет гидрофобных взаимодействий их амфифильных конъюгатов, способных самопроизвольно ассоциироваться с липидным бислоем плазматической мембраны.

Основные отличия и преимущества настоящего метода от описанного ранее способа ковалентной конденсации модифицированных остатков полисахаридов клетки с Рис. 19. Схема получения ациламиноалкильных производных олигонуклеотидов.

активированными производными фосфитов олигомеров (Chandra 2006) состоят в том, что эффективная иммобилизация практически не требует ни временных затрат, ни специальных абиогенных обработок клеток. Выбор структуры конъюгатов основывался на анализе опыта получения подобных производных для генотерапевтических целей и встраивания их в липосомы и обусловлен следующими основными факторами: необходимость обеспечить минимальное влияние на жизнедеятельность клетки и чужеродной ДНК, и гидрофобной части конъюгата;

растворимость модифицированных олигонуклеотидов в культуральной среде;

доступность зафиксированной ДНК к гибридизации. Отметим, что быстрая биодеградация олигонуклеотидов, препятствующая их терапевтическому применению, в случае ДНК-маркирования не столь критична. Достаточное для манипуляций время жизни комплекса "клетка-олигонуклеотид" может составлять десятки минут, во всяком случае, быть менее или соизмеримо со временем цикла клеточного деления. В результате была выбрана простая структура жирнокислотных производных фосфодиэфирных олигонуклеотидов, которые синтезировали конденсацией аминоалкилолигомеров (в том числе флуоресцентномеченных) с активированными производными стеариновой или пальмитиновой кислот (рис. 19).

Флуоресцентная микроскопия показала, что полученные FAM-меченые жирнокислотные производные олигонуклеотидов с примерно одинаковой эффективностью фиксируются на клетках (рис. 20 A). Олигонуклеотиды без жирнокислотных остатков фиксируются на незначительном количестве клеток (рис.

20 B), причем – мертвых, как было подтверждено экспериментами с окрашиванием клеток пропидий иодидом (рис. 20 G и H). Одновременное окрашивание клеток действием клеточного маркера CellTrace Far Red DDAO-SE (CTFR), ковалентно метящим клеточные белки, показало, что флуоресцирующие объекты – не агрегаты, которые могут быть образованы дифильными молекулами олигонуклеотидов, а именно клетки, и что эти молекулы располагаются в клеточной мембране (рис. C, D). Последний факт подтверждается и распределением FAM-флуоресценции меченых олигонуклеотидов и CTFR по профилям живой и мертвой клеток (рис. 20 E и 20 F соответственно).

Проточная цитометрия показала, что флуоресценция клеток линейно зависела от концентрации жирнокислотных производных меченых олигонуклеотидов в интервале 0,050,2 мкМ Олигонуклеотидный дуплекс, состоящий из жирнокислотного конъюгата и комплементарного ему меченного олигонуклеотида, также эффективно Рис. 20. Флуоресцентная фиксируется на поверхности клеток.

микроскопия клеток Jurkat, После закрепления на клетках меченных олигонуклеотидами FT18NSte и FT18N.

жирнокислотных производных олигонуклеотидов они остаются доступными для образования дуплексов. Например, как показано на рис. 21 A, вся клеточная популяция, предварительно инкубированная с T18NSte, приобрела сильный флуоресцентный сигнал после обработки ее FAM-олигонуклеотидом FA25, комплементарным к T18NSte.

При этом интенсивность сигнала в гораздо большей степени зависела от концентрации предварительно связанного T18NSte, чем от концентрации FA25 (рис. 21 B).

Рис. 21. Гибридизация разных количеств Флуоресцентная микроскопия олигонуклеотида T18NSte, фиксированного на клетках Jurkat, с комплементарным подтвердила, что только олигонуклеотидом FA25.

предварительно обработанные T18NSte клетки флуоресцируют после добавления FA25 (рис. 21 C - E). Сходные результаты были получены и для олигонуклеотидов T18NPal и T25NSte.

При инкубировании тех же клеток с некомплементарными к T18NSte FAMолигомерами флуоресценция не наблюдалась. Олигонуклеотиды, содержащие жирнокислотные остатки, одинаково хорошо фиксировались на внешней мембране различных клеток как растущих в суспензионной культуре, так и прикрепленных к поверхности. На рис. 22 приведена флуоресцентная микрофотография макрофагов линии J774, инкубированных с FT18NSte. В этом случае были подтверждены закономерности, найденные для клеток линии Jurkat по следующим показателям:

цитотоксичность, распределение меченых производными олигонуклеотидов по профилям живых и мертвых клеток, зависимость нагрузки олигонуклеотидов на клетку от их концентрации. Очевидно, есть все основания утверждать, что данный метод фиксации олигонуклеотидов можно успешно применять для широкого круга клеток.

Таким образом, было установлено, что ациламиноалкильные производные олигодезоксирибонуклеотидов при внесении в клеточную культуру, помещенную в фосфатно-солевой буфер или в бессывороточную среду, способны Рис. 22. Флуоресцентная самопроизвольно нековалентно фиксироваться на микрофотография макрофагов внешней поверхности живых клеток, не изменяя линии J774, обработанных олигонуклеотидом FT18NSte.

жизнеспособности последних в стандартных условиях культивирования, а также способны в связанном состоянии гибридизоваться с комплементарными фрагментами ДНК, которые могут быть присоединены к другим клеткам, везикулам, молекулам, поверхностям.

4. Ассоциаты наночастиц никеля с олигонуклеотидами и белками. Одно из направлений в нанотехнологии состоит в получении новых материалов с использованием фрагментов ДНК, ковалентно связанных с наноразмерным носителем, например, частицами золота (Crocker 2008). В сравнении с ранее описанными платформами, наночастицы никеля обладают рядом привлекательных свойств, обусловленных их электропроводными и магнитными характеристиками, а также уникальной способностью удерживать гистидинилированные белки (Becerril 2006, Лазарев 2007). Поэтому создание на их основе функциональных биополимерных структур для использования в биосенсорах и различных диагностических системах представляет значительный интерес. Однако, закономерности процессов сборки ассоциатов a наночастиц никеля с олигонуклеотидами и белками до сих пор не изучены. Так, например, известно, что непосредственная металлизация ДНК путем восстановления катионов никеля приводит к потере конформации и природных свойств полинуклеотида (Becerril 2005,2006). Особенно важно в этой связи b изучить условия образования комплексов и подтвердить целостность и функциональность молекул в их составе.

В работе показана способность агрегатов наночастиц никеля ассоциироваться с фрагментами однонитевых ДНК фосфодиэфирной и тиофосфорильной природы с образованием c стабильных комплексов. Анализ изотерм адсорбции различных олигонуклеотидов свидетельствует о зависимости параметров связывания олигомеров от их длины, нуклеотидного состава, природы межнуклеотидных связей (данные приведены в Рис. 23. Влияние на диссертации).

эффективность ассоциации олигонуклеотидов с С целью оптимизации условий образования Niнаночастицами никеля: а) биополимерных ассоциатов было рассмотрено также ионной силы растворов олигонуклеотида 5'-FAMвлияние на эффективность адсорбции олигомеров CCCTTCTCAGTTAGGGTTAG ионной силы (см. рис. 23 а) и рН (см. рис. 23 b) в фосфатно-солевом буфере; b) рН растворов олигомера 5'- растворов, а также концентрации имидазола, CCCTTCTCAGTTAGGGTTAG;

блокирующего образование координационных связей c) концентрации имидазола в растворах того же олигомера.

(см. рис. 23 c). На примере двух рекомбинантных С1 – суммарная концентрация связанного и свободного гистидинилированных белков исследовано олигонуклеотида, С2 – образование протеин-никелевых комплексов.

концентрация ДНК-Ni комплексов.

Получены изотермы адсорбции белков наночастицами никеля (рис.24). Методом MALDITOF масс-спектрометрии показано, что в составе комплексов молекулы биополимеров не деградированы.

В экспериментах по гибридизации Ni-олигонуклеотидных комплексов показано, что o Рис. 24. Изотермы адсорбции Рис. 25. Изотермы адсорбции (20 С) ассоциатами o наночастицами никеля (20 С) Т30-Ni комплементарного (dA30) и рекомбинантных гистидинилированных некомплементарного (dC30) олигомеров. С1 – белков GFP и 3D. С1 – суммарная суммарная концентрация связанного и свободного концентрация связанного и свободного олигонуклеотида, С2 – концентрация ДНК-Ni белка, С2 – концентрация связанного белка.

комплексов.

Ni-связанные олигомеры способны избирательно удерживать комплементарные последовательности. Так, комплекс Ni-T30 заметно лучше удерживал комплементарный олигомер dA30 в сравнении с олигомером dC30 (рис. 25).

На примере белка GFP показано, что выделенный из состава комплекса с Ni белок не изменял своих исходных флуоресцентных свойств. Более того, оказалось, что в составе комплекса GFP сохранил способность избирательно удерживать аптамерные олигонуклеотиды Agfp1 и Agfp2 с образованием Ni-нуклеопротеиновых комплексов.

Рис. 26. A. Изотермы адсорбции (20 oС) ассоциатов GFP-Ni с GFP-аптамерами Agfp1, Agfp2 и dC30. B - изотермы адсорбции аптамеров за вычетом поправки на неспецифическое связывание С1 – суммарная концентрация связанного и свободного олигонуклеотида, С2 – концентрация ДНК-Ni комплексов.

Причем, как видно из рис. 26 А, эффективность связывания аптамеров (Agfp1 и Agfp2) и случайной последовательности существенно различались. Отметим, что преимущество Agfp1 в сравнении с Agfp2 коррелирует и с литературными данными (Stanlis 2003).

Полученные результаты свидетельствуют о том, что в составе ассоциатов биополимеры могут частично или полностью сохранять функциональные свойства.

Приведенные новые данные подтверждают перспективность использования биополимер-никелевых наноструктур в качестве исследовательских и диагностических инструментов в молекулярной наноэлектронике, биологии и медицине.

Выводы 1. Сформулирован новый подход к созданию транспортных белков для доставки чужеродной ДНК в клетки-мишени, в соответствии с которым получен ряд новых полипептидов, в том числе белок PGEk, состоящий из адресующего ЭФРч домена и олигокатионной ДНК-связывающей последовательности, мотива сигнала ядерной локализации.

2. Синтезированы новые белок-белковые и ДНК-белковые конъюгаты с применением природных и рекомбинантных белков, способные избирательно интернализоваться целевыми клетками по рецептор-опосредованному механизму и обеспечивать доставку нуклеиновой компоненты к внутриклеточным мишеням. Для конструирования такого рода транспортных систем получен ряд рекомбинантных белков, в том числе эпидермальный фактор роста человека, а также слитый белок стрептавидин-дифтерийный токсин для транспорта биотинилированных объектов.

3. Изучены механизмы образования и структурно-функциональные свойства комплексов PGEk и его гомолога PGEkR с фрагментами ДНК, предложены гипотетические механизмы транслокации нуклеопротеиновых ассоциатов и их взаимодействий с внутриклеточными мишенями. Найденные подходы и закономерности имеют системный характер и являются важными для конструирования новых переносчиков ДНК, селективных к различным типам клеток.

4. Для создания супрамолекулярных ассоциатов ДНК, с живыми клетками предложен новый способ фиксации олигонуклеотидов на внешней поверхности клеток, использующий синтетические жирнокислотные производные олигонуклеотидов. Показано, что при внесении таких конъюгатов в культуральную среду ДНК эффективно удерживается на внешней мембране клеток, не изменяя их жизнеспособности и сохраняя свои гибридизационные свойства. Получены комплексы клетка-олигомер-комплементарный олигонуклеотид. Найденный метод ДНК-маркирования клеток перспективен для создания биосенсоров, разработки новых подходов в инженерии тканей, получения искусственных межклеточных ассоциатов.

5. В работе продемонстрирована принципиальная возможность и перспективность использования наночастиц никеля для формирования многофункциональных биополимерных структур, а также их преимущества в сравнении с другими наноразмерными основами. Найдены условия получения комплексов ДНК-Ni, протеин-Ni и нуклеопротеин-Ni, в составе которых молекулы биополимеров не деградированы и могут частично или полностью сохранять функциональные свойства. Полученные результаты вносят вклад в создание новых биополимер-никелевых наноструктур.

6. Для создания различных ДНК-содержащих комплексов и их многофакторного структурно-функционального анализа разработаны и оптимизированы способы получения олигонуклеотидов и контроля их качества, в том числе метод параллельной сборки локально тиофосфорилированных олигомеров; рассмотрены особенности синтеза и очистки олигомеров, несущих флуоресцентные метки, а также проведены конформационные исследования ДНК. С их применением разработан ряд диагностикумов патогенов, получены новые штаммы-продуценты белков (атриального натрийуретического фактора, кальцитонина, гормона роста, эпидермального фактора роста, цитохромов и др.), трансгенные вирусы (на основе Хвируса картофеля) и растения (арабидопсис, табак и картофель). Разработанные методы и технологические приемы внедрены в производство диагностических наборов для определения широкого круга наследственных и различных инфекционных заболеваний, используются в производстве отечественных синтезаторов.

Список основных статей по теме 1. Позмогова Г.Е., Чернов Б.К., Голова Ю.Б., Баев А.А. Твердофазный синтез олигодезоксирибонуклеотидов с применением фосфамидитных динуклеотидных блоков. // Доклады АН СССР. 1986. Т. 291. №5. С. 1131-1134.

2. Чернов Б.К., Голова Ю.Б., Позмогова Г.Е. Быстрое удаление pнитрофенилэтильной защитной группы с 06 -положения гуанидинового основания. // Биоорганическая химия. 1987. Т. 13. №8. С. 1136-1138.

3. Жвирблис Г.С., Горбулев В.Г., Рубцов П.М., Чернов Б.К., Голова Ю.Б., Позмогова Г.Е., Скрябин К.Г., Баев А.А. Генетическая инженерия пептидных гормонов. Клонирование к-ДНК гормона роста свиньи и конструирование гена для экспрессии гормона в бактериях. // Молекулярная биология. 1988. Т. 22. №1. С. 145150.

4. Краев А.С., Морозов С.Ю., Лукашева Л.И., Розанов М.Н., Чернов Б.К., Позмогова Г.Е., Симонова М.Л., Голова Ю.Б., Белжеларская С.Н., Скрябин К.Г., Атабеков И.Г. Первичная структура и организация генома X-вируса картофеля. // Доклалы АН СССР. 1988. Т. 300. №3. С. 711-717.

5. Ирисбаев Б.К., Краев А.С., Абдукаримов А.А., Позмогова Г.Е., Скрябин К.Г.

Клонирование родоспецифического ДНК-зонда из гриба Fusarium oxysporum. // Молекулярная биология. 1991. Т. 25. С. 1667-1669.

6. Кочкина В.М., Морозов И.А., Франк Е.Г., Карпычев И.В., Рудик О.А., Чернов Б.К., Позмогова Г.Е., Венкстерн Т.В., Баев А.А. К вопросу о существовании в скелетных мышцах кролика ветвящего фермента рибонуклеопротеидной природы и соответствующего рибозима. // Молекулярная биология. 1991. Т. 25. С. 1546-1564.

7. Бызова М.В., Краев А.С., Позмогова Г.Е., Скрябин К.Г. Молекулярная характеристика фрагментов генов семейства халконсинтетазы двух видов хлопчатника с помощью метода полимеразной цепной реакции. // Молекулярная биология. 1992. Т. 26. №4. С. 193-200.

8. Бызова М.В., Краев А.С., Позмогова Г.Е., Скрябин К.Г. Идентификация с помощью ревертазной полимеразной цепной реакции генов халконсинтетазы специфически экспрессирующихся в тканях лепестков двух видов хлопчатника Gossypium hirsutum 108F и Gossypium herbaceum. // Молекулярная биология. 1992. Т.

26. №4. С. 940-944.

9. Рысков А.П., Куприянова Н.С., Капанадзе Б.И., Нечволодов К.К., Позмогова Г.Е., Просняк М.И., Янковский Н.К. Оценка частоты встречаемости некоторых мини- и макросателлитных последовательностей в ДНК хромосомы 13 человека. // Генетика.

1993. Т. 29. №10. С. 1750-1754.

10. Schulga A.A., Levichkin I.V., Kurkbanov F.T., Okorokov A.L., Pozmogova G.E., Kirpichnikov M.P. An approach to construction of hybrid polypeptide moleculeshomologue recombination method. // Nucleic Acids Res. 1994. V. 22. №18. P. 3808-3810.

11. Акимчева С.А., Рябченко Н.Ф., Миронов В.Н., Голышин П.Н., Позмогова Г.Е., Троицкая Е.Н., Абдукаримов А., А., Скрябин К.Г. Молекулярно-генетический анализ коллекции среднеазиатских штаммов B. thuringiensis. // Биотехнология. 1994. Т. 34.

№4. С. 21-24.

12. Гулина И.В., Шульга О.А., Миронов В.Н., Ревенкова Е.В., Краев А.С., Позмогова Г.Е., Яковлева Г.А., Скрябин К.Г. Экспрессия частично модифицированного гена dэндотоксина из B. thuringiensis var tenebrionis в трансгенных растениях картофеля. // Молекулярная биология. 1994. Т. 28. №5. С. 1166-1175.

13. Николаидис М.Н., Парсаданян А.Ш., Позмогова Г.Е., Эльдаров М.А., Ананьева Н.М., Майсурян Н.А., Галоян А.А. Синтез и секреция в E. coli предсердного натрийуретического фактора человека в виде С-концевого гибрида с белком А St.

aureus. // Молекулярная биология. 1994. Т. 28. №5. С. 1098-1105.

14. Bagyan I.L., Revenkova E.V., Pozmogova G.E., Kraev A.S., Skryabin K.G. 5'Regulatory region of Agrobacterium tumefaciens T-DNA gene 6b directs organ-specific, wound-inducible and auxin-inducible expression in transgenic tobacco. // Plant Mol Biol.

1995. V. 29. №6. P. 1299-1304.

15. Щенникова А.В., Краев А.С., Позмогова Г.Е., Скрябин К.Г. Клонирование ДНКзондов для обнаружения и идентификации патогенных грибов. // Молекулярная биология. 1996. Т. 30. №6. С. 1268-1273.

16. Шемякин И.Г., Анисимова В.А., Копылов П.Х., Позмогова Г.Е., Чувилин А.Н., Манзенюк О.Ю., Лось Т.А., Щербаков Г.Я. Конструирование и экспрессия в клетках E. coli гибридного белка дифтерийный токсин-стрептавидин. // Молекулярная биология. 1997. Т. 31. №5. С. 790-794.

17. Миронов В.Н., Краев А.С., Чернов Б.К., Позмогова Г.Е., Ульянов А.В., Голова Ю.Б., Симонова М.Л., Гордеев В.К., Скрябин К.Г. Гены биосинтеза рибофлавина Bacillus Subtilis - полная первичная структура и модель организации. // Доклалы АН СССР. 1998. Т. 305. №2. С. 482-488.

18. Позмогова Г.Е., Кнорре Д.Г. Белковые и пептидные конструкции для доставки в клетку олигонуклеотидов и ДНК. // Вопросы медицинской химии. 1998. Т. 44. №4. С.

331-347.

19. Семенова С.К., Хрисанфова Г.Г., Асатрян А.М., Мовсесян С.О., Позмогова Г.Е., Рысков А.П. Генетическая изменчивость Trichinella spiralis Oven,1835 и Trichinella pseudospiralis Garkavi,1972, выявляемая методом полимеразной цепной реакции со случайными праймерами. // Генетика. 1998. Т. 34. №4. С. 528-524.

20. Борисова О.Ф., Щелкина А.К., Харитонов В.А., Позмогова Г.Е., Лившиц М.А., Флорентьев В.Л. Четырехцепочечные комплексы, образованные из 3’d(GT)5pO(CH2CH2)3p-d(GT)5-3’ олигонуклеотидов. // Молекулярная биология.

1999. Т. 33. №3. С. 503-511.

21. Shchyolkina A.K., Borisova O.F., Livshits M.A., Pozmogova G.E., Chernov B.K., Klement R., Jovin T.M. Parallel-stranded DNA with mixed AT/GC composition: role of trans G.C base pairs in sequence dependent helical stability. // Biochemistry. 2000. V. 39.

№33. P. 10034-10044.

22. Игнатов А.Н., Кугинуки Я., Супрунова Т.П., Позмогова Г.Е., Сеитова А.М., Дорохов Д.Б., Хираи М. RAPD-маркеры, сцепленные с локусом устойчивости к расе возбудителя сосудистого бактериоза anthomonas campestris pv. campestris (Pamm.) Dow., у Brassica rapa L. // Генетика. 2000. Т. 36. №3. С. 357-360.

23. Борисова О.Ф., Щелкина А.К., Ильичева И.А., Позмогова Г.Е. Конформационный полиморфизм и растяжимость квадруплексов ДНК, образованных из d(GT)n повторов.

// Молекулярная биология. 2001. Т. 35. С. 860-867.

24. Игнатов А.Н., Монахос Г.Ф., Джалилов Ф.С., Позмогова Г.Е. Ген авирулентности Xanthomonas campestris pv. campestris. гомологичный локусу avrBs2, узнается при расово-специфичной реакции двумя генами устойчивости растений рода Brassica. // Генетика. 2002. Т. 38. №12. С. 1656-1663.

25. Besschetnova I.A., Pozmogova G.E., Shchyolkina A.K., Borisova O.F. The effect of the secondary and tertiary structure of d(TTAGGG)n telomeric oligonucleotides on their binding with a novel recombinant protein PGEk – deliver of DNA in cells. // J. Biomol Struct. Dyn. 2005. V. 22. P. 859-860.

26. Позмогова Г.Е., Чувилин А.Н. Адресованные белок-нуклеиновые комплексы для генотерапии. I. Конструирование нового белкового рекомбинантного переносчика. // Новые лекарственные препараты. 2005. №11. С. 66-71.

27. Позмогова Г.Е., Посыпанова Г.А. Адресованные белок-нуклеиновые комплексы для генотерапии. II. Доставка чужеродной ДНК в клетки-мишени с помощью нового рекомбинантного белка PGEk. // Новые лекарственные препараты. 2005. №11. С. 7280.

28. Посыпанова Г.А., Киреева Н.Н., Макаров В.А., Фаттахова Г.В., Попова О.Н., Позмогова Г.Е., Северин С.Е., Северин Е.С. Использование альфа-фетопротеина для адресной доставки антисмысловых олигонуклеотидов в опухолевые клетки:

сравнение двух конструкций. // Вопросы биологической, медицинской и фармацевтической химии. 2005. №3. С. 15-20.

29. Бессчетнова И.А., Позмогова Г.Е., Чувилин А.Н., Щелкина А.К. Комплексы теломерных олигонуклеотидов d(TTAGGG)4 с новым рекомбинантным белковым вектором PGEk - переносчиком нуклеиновых кислот в пролиферирующие клетки. // Молекулярная биология. 2006. Т. 40. №3. С. 489-496.

30. Zaitseva M.A., Kaluzhny D.N., Shchyolkina A.K., Borisova O.F., Pozmogova G.E.

The influence of different local thiophosphoryl internucleotide bonds on the d(GGTGGTTGTGGTGGT) conformation. // J. Biomol. Struct. Dyn. 2007. V. 24. P. 830831.

31. Позмогова Г.Е., Чувилин А.Н. Принципы создания белковых переносчиков ДНК.

Новые производные эпидермального фактора роста человека для генотерапии. // Бюлл эксперим биол и мед. 2007. Прилож. 2. С. 87-93.

32. Лукьянова Т.А., Зайцева М.А., Карпов В.А., Позмогова Г.Е. Синтез и массспектрометрия олигонуклеотидов, несущих тиофосфорильные модификации заданной локализации. // Биоорганическая химия. 2008. Т. 34. №1. С. 83-88.

33. Позмогова Г. Е., Чувилин А. Н., Смирнов И. П., Зайцева М. А., Татаринова О. Н., М. Г.В. Получение и свойства ассоциатов наночастиц никеля с ss-ДНК и белками. // Российские нанотехнологии. 2008. Т. 3. №5-6. С. 148-154.

34. Посыпанова Г.А., Чувилин А.Н., Киреева Н.Н., Северин Е.С., Позмогова Г.Е.

Влияние стехиометрии комплексов теломерных олигонуклеотидов с белковым вектором PGEk на их антипролиферативную активность и интернализацию клеткамимишенями. // Молекулярная биология. 2008. Т. 42. №2. С. 1-9.

35. Татаринова О.Н., Лукьянова Т.Н., Зайцева М.А., Веремеев К.Ю., Карпов В.А., Чувилин А.Н., Петрунин Д.Д., Позмогова Г.Е. Влияние способов очистки олигодезоксирибонуклеотидных зондов на эффективность генодиагностики методом PCR в режиме реального времени. // Бюлл. эксперим. биол. и мед. 2008. Т. 145. №3. С.

275-280.

36. Timofeeva M., Felgenhauer P., Sedman J., Shostak N., Kupriyanova N., Pozmogova G., Lind A., Bayev А.A. Loach (Misgurnus fossilis) oocyte 5S rRNA gene: heterogeneity of the primary structure and location of transcription stimulatory signal in their upstream spacer. // Nucleic structure and function. Eds: J.R. Harris, I.B. Zbarsky. 1990. P. 143-147.

37. Bagyan I.L., Kraev A.S., Pozmogova G.E., Skryabin K.G. The 5’-untranslated leaders of BSMV RNAgamma and PVX coat protein mRNA as translational enhancers in tobacco protoplasts. // Genom Structure and Function C. Ed: Nicolini С., Kluwer Academic Publishers, Netherlands. 1997. P. 319-323.

38. Eldarov M.A., Sidorovich V.E., Pozmogova G.E., Skryabin K.G. Targeted expression of mammalian cytochromes P45002В4 and P450SCC in yeast Saccharomyces cerevisiae. // Biohpysics of Electron Transfer and Molecular Bioelectronics ELBA Forum Series, Ed:

Nicolini С.,Plenum Publishing Corporation NY, London. 1998. V. 3. P. 91-102.

39. Эльдаров М.А., Позмогова Г.Е., Кагиянц С.М., Луценко С.В., Северин Е.С., Кирпичников М.П., Скрябин К.Г. Штамм дрожжей S. cerevisiae BKM CR-349D - продуцент эпидермального фактора роста человека. // Патент РФ №21505001. 1999.

40. Позмогова Г.Е., Чувилин А.Н., Посыпанова Г.А., Шульга А.А., Эльдаров М.А., Ермолюк Я.С., Северин Е.С., Кирпичников М.П., Скрябин К.Г. Пептидный вектор, способ его получения, нуклеотидная последовательность, рекомбинантная плазмидная ДНК и штамм Escherichia coli В-8389 ВКПМ для его получения, способ генетической модификации клеток млекопитающих и человека. // Патент РФ № 2248983. 2005.

Список тезисов по теме 41. Позмогова Г.Е., Розанов М.Н., Симонова М.Л., Априкян П.Г. Геном протексвирусов: секвенирование X-вируса картофеля и предсказание функций продуктов вирусных генов. // Тез. IV Межд. конф. по генетике. 1989. Варна. НРБ.

С.73-77.

42. Позмогова Г.Е. Блочный синтез олигодезоксирибонуклеотидов на твердой фазе в неавтоматическом режиме с использованием фосфатных и фосфамидитных димерных блоков. Синтез генов пептидных гормонов. //Тез. IV Межд. конф. по генетике. 1989.

Варна. НРБ. С.27-31.

43. Позмогова Г.Е., Чернов Б.К., Голова Ю.Б., Гнучев Н.В. Применение ион-парной ВЭЖХ для разделения сложных смесей синтетических олигодезоксирибонуклеотидов. // Тез. VI Всес. Симп. по межфазной жидкостной хроматографии 1989.

Алма-Ата. С. 82.

44. Скрябин К.Г., Рябченко Н.Ф., Миронов В.Н., Шульга О.А., Пугин М.М., Ревенкова Е.В., Краев А.С., Позмогова Г.Е. Принципы получения устойчивых растений. // Тез. I Всес. симп." Новые методы биотехнологии растений", Пущино.

1991. С. 10.

45. Краев А.С., Шульга О.А., Пугин М.М., Ревенкова Е.В., Карпычев И.В., Эльдаров М.А., Позмогова Г.Е., Скрябин К.Г. Проблемы оптимизации экспрессии трансгенов. // Тез. I Всесоюзн. симп. "Новые методы биотехнологии растений". Пущино. 1991. С.

93.

46. Головко А.Э., Акимчева С.А., Голышин П.Н., Рябченко Н.Ф., Степанов А.И., Позмогова Г.Е., Скрябин К.Г. Поиск и молекулярно-генетический анализ новых энтомопатогенных штаммов Bacillus thuringiensis.//Тез. докл. V Конф. "Новые направления биотехнологии". Пущино. 1992. С.17.

47. Skryabin K.G., Bagyan I.L., Gulina I.V., Kraev A.S., Padegimas L.S., Pooggin M.M., Revenkova E.V., Schennikova A.V., Shulga O.A., Sokolova M.A., Pozmogova G.E.

Production of transgenic plants resistant to viruses, insects and herbicides: optimization of heterologous gene expression. // Conf. Pap. Of 10-th Anniversary Otto Warburg Symp.

"Molecular Biology & Plant breeding: Theoretical, practical & legal aspects". March 1994.

P. 87.

48. Suprunova T.P., Bocharnicova N.I., Pozmogova G.E., Dorokhov D.B. RAPDanalysis of interspecific hybrids Licopersicon Esculentum mill. and Sulanum Pennellii cor.

obtained by means of pollination with exogenous DNA. // Abst. Of The 7-th Intern.

Pollination Symp., Lethbridge, Canada.1996. Р.112.

49. Позмогова Г.Е., Чувилин А.Н. Конструирование транспортных комплексов:

белковый вектор - интеркалятор – ДНК для использования в генотерапии. // Тез. VIII Конф. "Новые направления биотехнологии". Москва. 1998. С. 64.

50. Сидорович В.Е., Бобровникова Е.В., Эльдаров М.А., Соколов Н.Н., Позмогова Г.Е., Арчаков А.И., Скрябин К.Г. Экспрессия цитохромов P45011A1 и P45002В4 в дрожжах Saccharomyces cerevisiae. // Тез. VIII Конф. "Новые направления биотехнологии". Москва. 1998. С. 66.

51. Щелкина А.К., Борисова О.Ф., Лившиц М.А., Чернов Б.К., Позмогова Г.Е., Джовин Т.М., Чуриков Н.А Структура и динамика нуклеиновых кислот и их комплексов. Новая двойная спираль ДНК с АT и GC трансуотсон-криковскими парами. // Тез. II Съезд биофизиков России. Москва. 1999. Т.1. С. 184-185.

52. Борисова О.Ф., Щелкина А.К., Харитонов В.А., Мамаева О.К., Лысов Ю.П., Позмогова Г.Е., Тимофеев Э.Н., Лившиц М.А., Флорентьев В.Л. Структура и динамика четырехцепочечных комплексов, образованных из d(GТ)n повторов. // Тез.

II Съезд биофизиков России. Москва.1999. Т.1. С. 98.

53. Pozmogova G.E., Chuvilin A.N., Posypanova G.A. Oligodeoxyribonucleotide- recombinant human epidermal growth factor (rEGFh) conjugates. // Abstr. Int. Conf.

"Trends in nucleic acid chemistry" Moscow. 2000. P. 13.

54. Pozmogova G.E., Chuvilin A.N., Posypanova G.А., Shulga A.A., Ermolyuk Ya.S., Kireeva N.N., Kirpichnikov M.P., Skryabin K.G. New EGF-based peptide vectors for antisense oligonucleotides and plasmid DNA target delivery into actively proliferating cells.

//Abstr. Int. Conf. "RNA as Terapeutic and Genomics Target". Novosibirsk. 2001. P. 83.

55. Позмогова Г.Е., Чувилин А.Н., Посыпанова Г.А., Шульга A.A., Ермолюк Я.С., Киреева Н.Н., Глухов А.И., Кирпичников М.П., Скрябин К.Г. Новый пептидный вектор EGF-NLS для доставки антисенс- олигонуклеотидов и плазмидной ДНК в опухолевые клетки. //Тез. "Биотехнология -2001". Пущино. 2001. С. 215.

56. Chernolovskaya E., Pimanova T., Chuvilin A., Pozmogova G., Vlassov V. Target delivery of antisence oligonucleotide into EGF-receptor expressing cells. // Abstr. Int. Conf.

"RNA as Terapeutic and Genomics Target". Novosibirsk. 2001. P. 75.

57. Позмогова Г.Е., Бессчетнова И.А., Щелкина А.К., Борисова О.Ф. Роль квадруплексной структуры d(TTAGGG)4 теломерной ДНК в связывании с пептидным вектором PGEk –переносчиком олигонуклеотидов в ядра клеток.// Тез. III Съезда биофизиков России. Воронеж. 2004. Т. 1. С. 134-135.

58. Позмогова Г.Е. Адресованные белок-нуклеиновые комплексы для генотерапии.

//Тез. XII Росс. Нац. Конгр. «Человек и лекарство». Москва. 2005. С. 293.

59. Позмогова Г.Е., Чувилин А.Н., Посыпанова Г.А., Бессчетнова И.А, Борисова О.Ф. Структура и свойства адресованных комплексов рекомбинантного белка PGEk с теломерным олигонуклеотидом d(TTAGGG)4 и его фосфотиоатным аналогом.//Тез.

Межд. конф., посвященной 80-летию со дня рождения академика Д.Г. Кнорре.

Новосибирск. 2006. С. 203.

60. Зайцева M.A., Калюжный Д.И., Лукьянова Т.А., Щелкина А.К., Борисова О.Ф., Позмогова Г. Е. Структурные исследования локально тиофосфорилированных олигонуклеотидов d(GGTGGTTGTGGTGGT), аналогов антитромбинового аптамера.

ХVIII Менделеевский съезд по общей и прикладной химии. Москва. 2007. Т. 4. С. 535.

61. Татаринова О.Н., Лукьянова Т.Н., Зайцева М.А., Карпов В.А., Чувилин А.Н., Позмогова Г.Е. Специфика обращено-фазовой ВЭЖХ олигодезоксирибонуклеотидных зондов для Real-Time PCR генодиагностики. // Тез.

III Межд. конф. "Фундаментальные науки - медицине". 2007. Новосибирск. С.143.

62. Pozmogova G.E., Chuvilin A.N. Artificial nucleoprotein complexes for gene therapy.

Constructing and structural-functional investigations // Abstr. IV Russian-French Symp "Supramlecular Systems in Chemistry and Biology". Moscow. 2007. V. 5. P. 36.

63. Позмогова Г.Е., Татаринова О.Н., Смирнов И.П. Формирование нуклеопротеиновых ассоциатов на основе наночастиц никеля. // Сб. трудов IV Съезда Российского общества биохимиков и молекулярных биологов. Новосибирск. 2008. С.

206.

64. Чувилин А.Н., Серебрякова М.В., Позмогова Г.Е. Деградация флуоресцентных меток на основе галогенированных ксантенов в условиях аммонолиза. // Сб. трудов IV Съезда Российского общества биохимиков и молекулярных биологов. Новосибирск.

2008. С. 205.

65. Smirnov I.P., Pozmogova G.E., Govorun V.M. DNA isolation and desalting directly on MALDI plate for MS analysis. // Proceedings of the 56-th ASMS Conference on Mass Spectrometry and Allied Topics. Colorado USA. 2008 ASMS CD 2008, TPB 040.




© 2011 www.dissers.ru - «Бесплатная электронная библиотека»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.