WWW.DISSERS.RU

БЕСПЛАТНАЯ ЭЛЕКТРОННАЯ БИБЛИОТЕКА

   Добро пожаловать!


На правах рукописи

ВЛАСЕНКО Людмила Петровна

ГОМОЛОГИ ГИСТОНА CENH3 У ВИДОВ СЕМЕЙСТВА BRASSICACEAE BURNETT И ЕГО ВЗАИМОДЕЙСТВУЮЩИЕ ПАРТНЁРЫ У ARABIDOPSIS THALIANA L.

Специальность: 03.02.07 – генетика А В Т О Р Е Ф Е Р А Т диссертации на соискание учёной степени кандидата биологических наук

Санкт-Петербург – 2012

Работа выполнена в ГНУ Всероссийский научно-исследовательский институт растениеводства им. Н.И. Вавилова Россельхозакадемии (г. СанктПетербург) и в Институте Лейбница генетики растений и исследования возделываемых культур, (г. Гатерслебен, Германия) в 2006-2010 гг.

Научный консультант: доктор биологических наук Чесноков Юрий Валентинович зав. лабораторией молекулярной и экологической генетики Всероссийского научно- исследовательского института растениеводства им. Н.И. Вавилова Россельхозакадемии

Официальные оппоненты: доктор биологических наук, профессор Борхсениус Сергей Николаевич зав. лабораторией структурной организации генома Института цитологии Российской академии наук доктор биологических наук Анисимова Ирина Николаевна ведущий научный сотрудник отдела генетики Всероссийского научно- исследовательского института растениеводства им. Н.И. Вавилова Россельхозакадемии

Ведущая организация: Санкт-Петербургский государственный университет

Защита состоится «17» октября 2012г. в 14 часов на заседании Диссертационного совета Д 006.041.01 Всероссийского научноисследовательского института растениеводства им. Н.И. Вавилова по адресу:

190000, г. Санкт-Петербург, ул. Большая Морская, д. 44.

Факс: +7-812-571-8728, e-mail: v.gavrilova@vir.nw.ru

С диссертацией можно ознакомиться в библиотеке Всероссийского научноисследовательского института растениеводства им. Н.И. Вавилова, с авторефератом на сайтах: http://vir.nw.ru и http://vak.ed.gov.ru

Автореферат размещён в интернете и разослан « » 2012 г.

Учёный секретарь диссертационного совета доктор биологических наук В.А. Гаврилова

ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ

Актуальность темы исследования. Центромерный вариант гистона H3 (СЕNH3) замещает обычный гистон Н3 в центромерном хроматине и служит основой центромерного белкового комплекса, играющего ключевую роль в процессах клеточного деления, которое составляет основу роста и размножения всех организмов, имеющих ядро, – эукариот. Современные исследования центромерных белковых комплексов приобретают особую значимость для генетики, поскольку это имеет принципиальное значение для изучения клеточных механизмов наследственности с целью управления этим процессом, а также для разработки и использования искусственных хромосом в качестве векторов для направленного тканеспецифичного трансгенеза.

В связи с этим, поиск и анализ de novo центромерных белков у растений является весьма актуальным. В качестве модельного объекта используется Arabidopsis thaliana, который имеет близкое родство с культурными хозяйственно ценными видами рода Brassica этого же семейства Brassicaceae. Геном арабидопсиса полностью секвенирован, а геном видов Brassica – нет; с 2003 года осуществляется международный проект по секвенированию геномов Brassica oleracea и Brassica rapa, включающий сравнение этих геномов с геномом арабидопсиса (http://www.brassica.info, http://brassica.bbsrc.ac.uk/).) Семейство Brassicaceae представляет интерес для сравнительно-генетических исследований, являясь в этом отношении экспериментальной моделью для растительного царства в целом. Для познания рода Brassica изучение центромерных гистонов Нявляется перспективным, поскольку представители этого рода обладают широкими возможностями для геномных комбинаций. Общепризнанно, что высокохромосомные виды B. napus L. (2n=38, геномы ААСС), B. juncea (L.) Czern. (2n=36, геномы ААВВ) и B.

carinata A. Braun (2n=34, геномы ВВСС) – амфидиплоидные (дигеномные) виды, произошедшие от элементарных (моногеномных) видов B. oleracea L. (2n=18, геном СС), B. campestris (2n=20, геном АА) и геном B. nigra (L.) Koch. (2n=16, геном ВВ) в результате гибридизации. Род Brassica дает исследователям уникальные возможности создания синтетических видов – как воспроизводящих природные виды, так и совершенно новые видовые формы (Лизгунова, 1984). Так, синтезирована B. composita –единственная существующая в настоящее время форма с геномом АВС (Монахос и др, 2001).

В связи с изучением гистона СЕNH3, предметом пристального внимания исследователей стали и авроры – семейство киназ, запускающих и регулирующих процесс клеточного деления. Несколько лет назад авроры были известны лишь у животных и дрожжей. Изучение аврор в растениях началось с компьютерного выявления ортологов аврор животных и дрожжей у Arabidopsis thaliana и некоторых других видов растений, в том числе культурных, принадлежащих к разным семействам. Была сделана попытка поиска взаимодействующих партнров авроры 1 в арабидопсисе (Courtuer, 2008), однако вопрос, фосфорилируют ли авроры в растениях центромерный вариант гистона Н3, как это было показано для других эукариот (Houben et al., 2007), остался открытым. Изучение воздействия авроры 1 на гистон СЕNH3 имеет значение для понимания механизма расхождения хромосом в процессах деления клетки, и таким образом представляет интерес для современной генетики.

Цель исследований Выявление и анализ гомологов гистона CENH3 у растений семейства Brassicaceae и поиск взаимодействующих с ним белков у Arabidopsis thaliana.

Задачи исследований:

провести поиск и сравнительный анализ взаимодействующих партнров гистона СЕNH3 методом связывания белков in vitro c рекомбинантным гистоном СЕNH3-His у модельного объекта для семейства Brassicaceae - Arabidopsis thaliana.

установить, фосфорилирует ли киназа аврора 1 гистон СЕNH3 методом киназной реакции между рекомбинантными ферментом и субстратом in vitro на модельном объекте Arabidopsis thaliana.

выявить наличие генов, кодирующих разные варианты гистона СЕNH3 и аврору 1 у представителей рода Brassica.

построить молекулярно-генетическое древо центромерных гистонов Н3 у различных видов растений.

Научная новизна:

1. Впервые осуществлн широкий поиск центромерных белков у высших растений, на материале модельного объекта семейства Brassicaceae Arabidopsis thaliana, методом связывания in vitro с гистоном СЕNH3. Впервые обнаружены семь компонентов белкового комплекса: 1) протеин, подобный фактору, связывающему ДНК, поврежднную ультрафиолетом (кодирует ген AT4G05420), 2) представитель семейства основных спираль-петля-спираль (кодирует ген bHLH) белков (кодирует ген AT5G01310), 3) белок из семейства FAD-ависимых оксидоредуктаз (кодирует ген AT2G22650), 4) предполагаемая протеин-киназа (кодирует ген AT3G09830), 5) предполагаемая протеинкиназа (кодирует ген AT2G28940), 6) предполагаемый поли-A-связывающий белок (кодирует ген AT2G24350), 7) белок, содержащий РНК-узнающий мотив, (кодирует ген AT4G17720).

2. Впервые на растительном объекте (Arabidopsis thaliana) продемонстрировано, что взаимодействующие партнры гистона СЕNH3 являются тканеспецифичными.

3. Впервые у высших растений (Arabidopsis thaliana) показано, что киназа из семейства аврор фосфорилирует гистон CENH3.

4. Впервые разработаны праймеры для выявления генов, кодирующих гистоны СЕNHу растений рода Brassica. Впервые получены ампликоны данных генов 5. Впервые на основе сравнительного анализа первичных аминокислотных последовательностей построено молекулярно-генетическое древо центромерных гистонов Н3 у растений.

Практическая значимость.

Разработаны праймеры для специфической амплификации гистона СЕNH3 у культурных видов рода Brassica: B. rapa, B. nigra, B. oleracea, B. juncea, B. napus, B.

carinata, B. compositа. Выявлено присутствие генов, кодирующих варианты гистона СЕNH3 у данных видов рода Brassica.

Разработаны праймеры для специфической амплификации киназы авроры 1 у видов рода Brassica: B. rapa, B. nigra, B. oleracea, B. juncea, B. napus, B. carinata, B. compositа.

Выявлено присутствие генов авроры 1 у данных видов рода Brassica.

Продемонстрировано явление тканеспецифичности взаимодействующих партнров гистона СЕNH3 у модельного объекта семейства Brassicaceae Arabidopsis thaliana.

Апробация работы.

Основные положения диссертации доложены на конференции «3rd Plant Science Student Conference» (Халле, Германия, 2007), на конференции 16th Internation Chromosome Conference (Амстердам, Нидерланды, 2007), на I Международной научно-практической конференции «Современные тенденции в селекции и семеноводстве овощных культур:

Традиции и перспективы» (ВНИИССОК, М., 2008), Международном симпозиуме «Молекулярно-генетические механизмы процессов метаболизма» (Кишинв, 2008), Международной научно-практической конференции «Вавиловские чтения - 2008» (Саратов).

Публикации.

По материалам исследований опубликовано 7 печатных работ, в том числе 3 - в изданиях, рекомендуемых ВАК.

Объм и структура диссертации.

Диссертация изложена на 106-и страницах машинописного текста, содержит таблиц и 23 рисунка. Состоит из введения, трх глав, заключения, выводов, практических рекомендаций и списка литературы, который включает 161 работу, в том числе 139 работ иностранных исследователей.

СОДЕРЖАНИЕ РАБОТЫ

ОБЗОР ЛИТЕРАТУРЫ Охарактеризованы особенности эволюция семейства Brassicaceae и геномной организации рода Brassica, и хозяйственное значение этого семейства. Описано проявление закона Н.И.Вавилова гомологических рядов в наследственной изменчивости на молекулярно-генетическом уровне. Дан анализ имеющихся литературных сведений о центромерных белках растений и животных, а также структуре и функциям центромерных белковых комплексов. Обобщн накопленный материал по аминокислотной структуре и роли центромерных гистонов Н3. Приведены литературные сведения о клеточной локализации и свойствах аврор, включая аврору 1 Arabidopsis thaliana. Обобщн опыт поиска белковых взаимодействий методом связывания белков in vitro. Представлена обобщенная постановка задач настоящего исследования.

МАТЕРИАЛЫ И МЕТОДЫ ИССЛЕДОВАНИЙ Материалом для молекулярно-генетических исследований служили коллекционные образцы видов рода Brassica: (геномы A, B, C, AB, AC, BC), а также новая синтетическая форму Brassica composita (геном ABC) из коллекций ГНУ ВИР Россельхозакадемии и Института генетики растений и исследования возделываемых культур (Гатерслебен, Германия); в качестве модельного объекта использовали образец дикого типа Arabidopsis thaliana из коллекции ГНУ ВИР Россельхозакадемии. В таблице 1 приводится перечень образцов, использованных для молекулярно-генетических исследований.

Таблица 1.

Состав проанализированных образцов видов рода Brassica L.

Номер по Русское Название Страна Латинское название каталогу название сорта происхождекультуры ВИР культуры, геном ния Brassica rapa L. subsp.

803 Репа (A) Соловецкая Россия rapa Brassica rapa L. subsp.

chinensis (L.) Hanelt var. Китайская – Китай communis (N.Tsen & 70 капуста (А) S.N.Lee) Hanelt Brassica rapa L. subsp. Пекинская pekinensis (Lour.) Hanelt капуста Местный Китай var. glabra E.Regel кочанная (A) Brassica nigra (L.) Горчица чрная W.D.J.Koch subsp. nigra – Дания – (B) var. nigra Brassica oleracea L.

Белокочанная convar. capitata (L.) Alef. Де-Фриз Россия var. capitata L. f. capitata 1669 капуста (С) АМ alba (L.) Duch. ex Lam.

Brassica oleracea L. Цветная капуста Отечествен convar. botrytis (L.) Alef. Россия 592 (C) ная var. botrytis L.

Brassica oleracea L. Цветная капуста convar. botrytis (L.) Alef. Гарантия Россия 681 (C) var. botrytis L.

Brassica oleracea L.

Венская белая Кольраби (C) convar. acephala (DC.) Россия 138 13Alef. var. gongylodes L.

Brassica oleracea L. Брюссельская convar. acephala DC. var. Геркулес 1342 Россия 86 капуста (C) gemmifera DC.

Brassica oleracea L. Листовая капуста Красная convar. acephala (DC.) курчавая Россия 97 (C) Alef. var. sabellica L. высокая Горчица Brassica juncea (L.) Czern. – Германия – сарептская (АB) Brassica napus L. subsp.

oleifera f. Annua Рапс (АС) (Schuebl.&Mart.) Thell. – – Германия “Janetzkis Weihenstephaner” Абиссинская Brassica carinata A.Braun 19-13/1 – Эфиопия капуста (BC) Brassica composita (АBC) Вр. 4- – Россия Поиск взаимодействующих партнров центромерного гистона Н3 (CENH3) проводили методом связывания белков in vitro. Для продукции рекомбинантного белка CENH3 применяли метод с His-полипептидом с использованием коммерческого набора материалов для конструирования вектора и экспрессии белка (Champion pET Directional TOPO Expression Kit, Invitrogen, США).

Выделение ядер из бутонов арабидопсиса и розеточных листьев 3-недельных растений арабидопсиса проводили, как описано ранее (Christensen, 2007) с незначительными изменениями. 0,5 г ткани разрушали в ступке при 4°C в 4 мл буфера A (20 мM Трис-HCl pH 8.5, 10 мM ЭДТА, 10 мM NaCl, 0,5 мM спермин, 0.5 мM спермидин, 250 мM сахароза, 10 мM 2-меркаптоэтанол, ингибитор протеаз: Complete, Mini, EDTA-free Protease Inhibitor Cocktail (Roche), согласно инструкции производителя). Суспензию фильтровали через нейлоновую ткань с порами размером в 70 мкм и центрифугировали в течение 5 мин. при 3000 g при 4°C. Осадок ресуспендировали в 4 мл буфера B (50 мM Трис-HCl pH 8.5, 5 мM MgCl2, 25% глицерол, 10 мM 2-меркаптоэтанол) и центрифугировали в течение 10 мин. при 3800 g при 4°C. Для разрушения ядер, осадок растворяли в 2 мл буфера для лизиса (50 мM Na2HPO4 pH 7.0, 300 мM NaCl, 10 мM имидазол, 0,005% Твин-20, 0,5% Тритон X-100, 0,5 мM ЭДТА, 3,5 мM 2-меркаптоэтанол, ингибитор протеаз: Complete, Mini, EDTA-free Protease Inhibitor Cocktail (Roche), согласно инструкции производителя) и помещали на 5 мин. в баню с ультразвуком (Transsonic digital, Elma). Затем образцы центрифугировали в течение 5 мин. при 13000 оборотах в минуту при 4°C в настольной центрифуге. Супернатант отбирали и 0,3 мл каждого образца разбавляли в 5 раз буфером для связывания белков. Для того чтобы доказать, что описанный выше метод позволяет добиться обогащния ядер, проводили Вестерн-блот анализ с антителами против гистона Н3 как маркра ядерной фракции белков.

Полученные таким образом препараты ядерного белка инкубировали с суспензией смолы с иммобилизованным белком CENH3-His, несвязавшиеся белки были удалены промыванием смолы буфером.

Белки из ядерных фракций, связавшиеся с белком CENH3-His, были разделены с помощью электофореза SDS-PAGE в 12% полиакриламидном геле согласно (Laemmli, 1970) и (Schagger et al., 1988). Для окрашивания белков гели во всех случаях обрабатывали Кумасси бриллиантовым синим R 250. Из дорожек геля, соответствующих бутонам и листьям арабидопсиса, были вырезаны самые насыщенные белковые полосы, и присутствующие в них белки были идентифицированы методом масс-спектрометрии.

Рекомбинантные фермент TAPi-AtAurora1, полученный с помощью плазмиды ntapi.289.gw.gck (Rohila, 2004), и субстрат CENH3-His использовали для проведения киназной реакции in vitro с применением радиоактивного ATФ[32P]. Фосфорилированный продукт реакции выявляли методом авторадиографии.

Поиск гомологов CENH3 и авроры 1 у видов рода Brassica проводили с помощью ПЦР на геномной ДНК. В случае CENH3 использовали пару праймеров: 5'ARAGAGATTCGCCAKTTCCAGAAG-3', где R=A/G, K=T/G и 5' CCATGGTCTGCCTTTTCCTCCAAGCCGGCG-3', сконструированную для консервативной части гистона на основе CENH3 арабидопсиса и идентифицированных нами гистонов CENH3 у представителей рода Brassica, как описано ниже. В случае авроры использовали пару праймеров, соответствующих началу и концу кДНК белка: 5'GAATGGCGATCCCTACGGAGACACAAC-3' и 5'-AACTCTGTAGATTCCAGAAG-3'.

Поиск гомологов гистона CENH3 арабидопсиса проводился с помощью программы BLASP в базе данных NCBI (http://blast.ncbi.nlm.nih.gov/) при стандартных настройках программы против неизбыточных белковых последовательностей у зелных растений.

Алгоритм поиска был следующим. Проводился запрос по последовательности С-конца гистона CENH3 у A. thaliana:

PGTVALKEIRHFQKQTNLLIPAASFIREVRSITHMLAPPQINRWTAEALVALQEAAEDYL VGLFSDSMLCAIHARRVTLMRKDFELARRLGGKGRPW.

Затем из полученного множества белков были удалены белки, подобные N-концу обычного гистона Н3 у Arabidopsis thaliana:

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFR.

Для обнаруженных таким образом гомологов гистона CENH3 стоилось молекулярно-генетическое древо на основе их коровых частей, продемонстрировавших сходство с С-концом гистона CENH3 у A. thaliana. Для построения молекулярногенетического древа была использована программа DNASTAR Lasergene 7 (DNASTAR, USA), при этом сравнительный анализ последовательностей проводился по методу Clustal V при стандартных настройках программы.

Последовательности белков CA127217 у Saccharum officinarum и TA35045_3708 у Brassica napus были получены на основе транскриптов из базы данных TIGR http://plantta.tigr.org/. Аминокислотная последовательность белка TC19006 у Saccharum officinarum была взята из публикации (Nagaki, Murata, 2005).

РЕЗУЛЬТАТЫ И ОБСУЖДЕНИЕ Поиск взаимодействующих партнров гистона CENHДля выявления круга взаимодействующих партнров центромерного гистона Н(CENH3) нами использовался рекомбинантный белок CENH3-His. После проведения эксперимента по связыванию белков с CENH3-His in vitro и электрофоретического разделения связавшихся белков (рис.1), из дорожек геля, соответствующих бутонам и листьям арабидопсиса, были вырезаны самые насыщенные белковые полосы, которые были затем подвергнуты протеазной обработке с получением пептидов.

На основе проведенного масс-спектрометрического исследования пептидов, полученных при протеазной обработке указанных на рисунке 1 полос геля, с помощью автоматической программы MASCOT была осуществлена идентификация соответствующих белков, при этом характеристики идентифицированных в эксперименте пептидов были сопоставлены с характеристиками в базах данных для пептидов, относящихся к известным белкам.

В результате проведенного анализа с помощью программы MASCOT выявлены белков, представленных в таблице 2. Некоторые белки – кодируемые генами AT4G054и AT2G28940 – были выявлены дважды; кроме того, как и следовало ожидать, был выявлен собственно белок-наживка.

170 kDa 130 kDa 95 kDa 72 kDa 55 kDa 43 kDa 34 kDa 26 kDa 17 kDa 11 kDa 1 2 M Рисунок 1. Связывание in vitro белков ядерной фракции арабидопсиса c CENH3His.

1 – бутоны арабидопсиса; 2 –листья арабидопсиса; M – маркр. Стрелками указаны полосы геля, использованные для масс-спектрометрического анализа.

Итак, в данном исследовании было выявлено cемь взаимодействующих партнров центромерного гистона Н3: UV-DDB – протеин, подобный фактору, связывающему ДНК, поврежднную ультрафиолетом (AT4G05420), представитель семейства основных спираль-петля-спираль (bHLH) белков (AT5G01310), белок из семейства FAD-зависимых оксидоредуктаз (AT2G22650), предполагаемые протеин-киназы (AT3G09830 и AT2G28940), предполагаемый поли-A-связывающий белок (AT2G24350), и белок, содержащий РНК-узнающий мотив, (AT4G17720).

Для выяснения их возможных функций, нами был проведн поиск ортологов данных белков с помощью программы BLASP в базе данных NCBI. Как известно, ортологи – это гены, произошедшие от единственного гена-предшественника у последнего общего предка сравниваемых видов; на практике для выявления ортологов Таблица 2.

Белки, идентифицированные с помощью программы MASCOT.

Полоса Генный локус Молекулярная Опознанные белки на геле масса белка Fb1 Белки не опознаны - - 1. протеин, подобный фактору, связывающему ДНК, поврежднную AT4G05420 811Fb2 ультрафиолетом AT5G01310 10132. представитель семейства основных спираль-петля-спираль (bHLH) белков Fb3 Белки не опознаны - - Fb4 Белки не опознаны - - Fb5 Белки не опознаны - - Fb6 Белки не опознаны - - 1. CENН3 АТ1G0131962. белок из семейства FAD-зависимых AT2G226Fb7 456оксидоредуктаз AT3G0984673.предполагаемая протеин-киназа Fb8 CENН3 АТ1G01370 196Fb9 Белки не опознаны - - Fb10 CENН3 АТ1G01370 196Fb11 Белки не опознаны - - L1 Белки не опознаны - L2 Белки не опознаны L3 Белки не опознаны предполагаемый поли(A)- связывающий L4 AT2G24350 616белок L5 CENН3 АТ1G01370 196L6 Белки не опознаны - - L7 предполагаемая протеин-киназа AT2G28940 5191. CENНАТ1G01370 1962.предполагаемая протеин-киназа L8 AT2G28940 3903.белок, содержащий РНК-узнающий AT4G17720 335мотив L9 Белки не опознаны - - L10 CENН3 АТ1G01370 196протеин, подобный фактору, L11 связывающему ДНК, поврежднную AT4G05420 811ультрафиолетом используется предположение, что ортологи более подобны друг другу, чем любым другим генам в сравниваемых геномах. Лишь один из выявленных нами взаимодействующих партнров центромерного гистона Н3, UV-DDB (At4g05420), обнаруженный как в бутонах, так и в листьях, гомологичен известному компоненту центромерного комплекса у другого объекта, а именно, человека (Obuse et al., 2004). Изучение данных по экспрессии белков в базе данных Genevestigator показало для некоторых из выявленных нами белков наиболее высокий уровень экспрессии в активно пролиферирующих тканях и органах, что косвенно поддерживает представления о вовлечении этих белков в процессы, связанные с центромерами.

Ген At4g05420 кодирует белок DDB 1A – главную субъединицу белка UV-DDB, связывающего ДНК, поврежднную ультрафиолетом (англ. UV-damaged DNA binding protein, DDB). Подавление экспрессии гена DDB-1 у S. pombe показало, что ген pombe DDB-1 не является жизненно необходимым, однако мутантные клетки демонстрировали нарушенную ядерную структуру, запаздывание хромосом при клеточном делении или повышенную чувствительность к веществу TBZ, что подразумевает важную роль этого белка в расхождении хромосом (Zolezzi et al., 2002). Анализ аминокислотной последовательности DDB-1 у человека выявил структуру -пропеллерного типа (Neuwald and Poleksic, 2000) как у белка Rik1p у дрожжей, который вовлечн в управление молчанием генов в центромерных районах и расхождением хромосом (Allshire et al., 1995). Следовательно, DDB-1 может принимать участие в регулировании динамики гетерохроматина в центромерном районе (Obuse et al., 2004).

DDB 1A арабидопсиса демонстрирует 51%-ную идентичность с белком DDB человека; белок DDB 1 у человека – известный компонент центромерного комплекса (Obuse et al., 2004). В клетках животных UV-DDB – главный белок, который связывает ДНК, содержащую повреждения, вызванные ультрафиолетом. Ход распознавания ДНК, поврежднной ультрафиолетом, белком UV-DDB изучался на примере человека (Fujiwara et al., 1999). Комплекс CUL4-DDB-ROC1 у человека служит гистоной убиквитиновой лигазой, и убиквитинизация гистонов H3 и H4 участвует в клеточном ответе на повреждение ДНК. Убиквитинизация гистонов H3 и H4, опосредованная комплексом CUL4-DDB-ROC1, регулируется ультрафиолетовой радиацией. Такая убиквитинизация ослабляет связь между гистонами и ДНК и облегчает проникновение к поврежднной ДНК репарирующих белков (Wang et al., 2006). DDB1 служит связующим звеном для вовлечения рецепторных белков группы WD40 в убиквитиновые лигазы CUL4-ROC1 (He et al., 2006).

Белок DDB 1 арабидопсиса демонстрирует 83%-ную идентичность с белком риса OsUV-DDB. Показано, что OsUV-DDB – важный компонент, вовлечнный в репарацию ДНК (Ishibashi et al., 2003). Субъединицы белка OsUV-DDB экспрессируются в пролиферирующих тканях риса, таких как меристема, но были обнаружены только в небольших количествах в зрелых листьях, несмотря на то, что листья подвергаются сильному воздействию ультрафиолета. Транскрипты OsUV-DDB были индуцированы в меристеме риса ультафиолетовым облучением. Уровень экспрессии OsUV-DDB был значительно уменьшен, когда пролиферация клеток была временно остановлена.

Следовательно, уровень экспрессии белка OsUV-DDB коррелирует с клеточной пролиферацией, и, возможно, его экспрессия нужна, главным образом, для репарации ДНК в процессе репликации ДНК (Ishibashi et al., 2003).

DDB1 в арабидопсисе, в составе комплекса с белком DET1, может регулировать экспрессию генов в ответ на световое воздействие при посредничестве белка HAT; таким способом DDB1 осужествляет негативную регуляцию транскрипции генов (Schroeder et al., 2002). Вместе с DET1, белок DDB1 арабидопсиса может быть вовлечн в комплекс CDD, который способен вызывать убиквитинизацию для регуляции фотоморфогенеза (Yanagawa et al., 2004). База данных Genevestigator показывает самый высокий уровень экспрессии At4g05420 в каллусе, гипокотиле, ксилеме и корковом слое арабидопсиса.

At5g01310 кодирует белок из семейства транскрипционных факторов спиральпетля-спираль. Это семейство пока еще слабо изучено в растениях, тогда как у животных установлено множество его различных функций, включая контроль клеточной пролиферации и развития специальных линий клеток (Heim et al., 2003). База данных Genevestigator показывает, что самый высокий уровень экспрессии At5g01310 отмечается в семенах и кончиках корней арабидопсиса.

At2G22650 кодирует белок из семейства FAD-зависимых оксидоредуктаз с самым высоким уровнем экспрессии в кончиках корней арабидопсиса (база данных Genevestigator).

Белки, кодируемые генами At2g24350 (предполагаемый поли-A-связывающий белок) и At4g17720 (предполагаемый регулятор сплайсинга), содержат РНК-узнающий мотив RRM (англ. RNA recognition motif). Мотивы RRM обнаружены в разнообразных РНК-связывающих белках и в нескольких белках, связывающих одноцепочечную ДНК (по сведениям базы данных консервативных доменов CDD – англ. conserved domain data base). Самый высокий уровень экспрессии At5g01310 – в верхней части проростков и плодолистиках; экспрессия гена At4g17720 в пыльце на несколько порядков выше, чем в других тканях (база данных Genevestigator).

At3g09830 и At2g28940 кодируют неохарактеризованные белки с серин/треонин киназными каталитическими доменами; энзиматическая активность киназ из этого семейства контролируется фосфорилированием (база данных CDD). Самый высокий уровень экспрессии At3g09830 наблюдается в старых листьях и на вершине боковых корней; самый высокий уровень экспрессии At2g28940 наблюдается в стебельных листьях, старых листьях, гипокотиле, ксилеме и корковом слое арабидопсиса (база данных Genevestigator).

Таким образом, полученные нами результаты указывают на значительные различия в белковом составе и структуре центромерных комплексов у растений и животных, что соответствует текущим представлениям о структуре растительного кинетохора (Yu et al., 2000) и сообщениям о локализации CENH3 у арабидопсиса и ячменя (Houben et al., 2007б;

Shibata, Murata, 2004). Принимая во внимание значительное количество установленных и предполагаемых кинетохорных компонентов у животных (Obuse et al., 2004; Foltz et al., 2006) и дрожжей (Cheeseman et al., 2002; Westermann et al., 2003; De Wulf et al., 2003), можно сделать вывод, что белки, выявленные в настоящем исследовании, по-видимому, представляют собой лишь часть компонентов растительного центромерного комплекса и для обнаружения полного белкового состава такого комплекса требуются дальнейшие исследования.

Киназное исследование in vitro с авророй 1 арабидопсиса и CENH3-His Проведенная нами киназная реакция in vitro с авророй 1 арабидопсиса и субстратом CENH3-His показала, что аврора 1 арабидопсиса фосфорилирует данный гистон (рисунок 2).

Полученные нами результаты по фосфорилированию in vitro гистона CENHарабидопсиса авророй 1, являются первым, и пока единственным, свидетельством киназной роли аврор по отношению к центромерным гистонам у растений. Как упоминалось выше, имеющиеся литературные данные свидетельствуют, что у животных фосфорилирование центромерного гистона Н3 киназой из семейства аврор предшествует фосфорилированию обычного гистона Н3 киназой из этого же семейства, и, вероятней всего, первое необходимо для второго. В свою очередь, фосфорилирование обычного гистона Н3 делает возможным протекание хромосомных преобразований в ходе деления клетки, по-видимому, за счт открепления хромосом от клеточного матрикса. Можно предполагать, что кроме запуска модифицирования обычного гистона Н3, фосфорилирование гистона CENH3 имеет значение для формирования внешнего комплекса центромерных белков, присутствующего на центромере только во время клеточного деления, однако механизм формирования внешнего комплекса центромерных белков пока неизвестен. В будущем предстоит установить аминокислоту, или аминокислоты, по которым происходит фосфорилирование гистона CENH3, установить связь этого модицифирования со стадиями клеточного деления, и выявить нисходящие биохимические пути.

Аврора CENH3-His 1 Рисунок 2. Киназное исследование in vitro с авророй 1 арабидопсиса и CENH3-His, авторадиография. 1 – отрицательный контроль; 2 – экспериментальный образец.

Гомологи авроры 1 и CENH3 у Brassica В исследовании по авроре 1 праймеры соответствовали началу и концу кДНК гена, при этом во всех образцах Brassica было выявлено присутствие одного основного продукта ПЦР-реакции, который совпадает по длине с контрольным продуктом в случае арабидопсиса - около 1800 п.н. (рисунок 3). То есть в данном случае для выявления ортологичных последовательностей геномной ДНК не потребовалось разрабатывать праймеры, соответствующие консервативной части белка.

1800 п.н.

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 M k- Рисунок 3. ПЦР анализ ДНК образцов Brassica с праймерами для авроры 1.

Обозначения: М – маркр, k- –отрицательный контроль. Нижний ряд полос на геле – избыток праймеров. Образцы были нанесены на два геля. Номера образцов следующие: 1.

B. oleracea L. convar. capitata (L.) Alef. var. capitata L. f. capitata alba (L.) Duch. ex Lam.; 2.

B. rapa L. subsp. chinensis (L.) Hanelt var. communis (N.Tsen & S.N.Lee) Hanelt; 3. В. carinata A.Braun; 4. B. rapa L. subsp. pekinensis (Lour.) Hanelt var. glabra E.Regel ; 5. B. oleracea L.

convar. botrytis (L.) Alef. var. botrytis L.. Сорт – Отечественная; 6. B. oleracea L. convar.

botrytis (L.) Alef. var. botrytis L.. Сорт – Гарантия; 7. B. oleracea L. convar. acephala (DC.) Alef. var. gongylodes L.; 8. B. oleracea L. convar. acephala DC. var. gemmifera DC.; 9.

Brassica rapa L. subsp. rapa; 10. B. oleracea L. convar. acephala (DC.) Alef. var. sabellica L.;

11. Arabidopsis thaliana L., положительный контроль; 12. B. napus L. oleifera f. annua (Schuebl.&Mart.) Thell. “Janetzkis Weihenstephaner”; 13. Brassica nigra (L.) W.D.J.Koch;

14.Brassica juncea (L.) Czern.; 15. Brassica composita.

Полученные результаты указывают на присутствие у Brassica генов с высокой степенью гомологии к авроре 1 арабидопсиса. Можно также выдвинуть предположение, что внутри рода Brassica, а также между исследованными видами рода Brassica и арабидопсисом нет существенной разницы по структуре авроры 1 и по е роли в фосфорилировании центромерного гистона Н3.

Для поиска гомологов центромерного гистона Н3 праймеры были сконструированы нами для консервативной части белка на основе данных по гистону CENH3 арабидопсиса и нескольким идентифицированным нами транскриптам CENH3 у Brassica с идентификационными номерами dbj|BAF49728.1, dbj|BAF49729.1|, TA35045_3708, dbj|BAF63143.1. Ввиду обнаруженного при этом значительного разнообразия в кодирующих последовательностях нам пришлось сконструировать один из двух праймеров вырожденным. Во всех случаях были обнаружены продукты ПЦР-реакции, и все они отличались по длине от контрольного продукта у арабидопсиса. В случаях моногеномных видов было обнаружено по одному ПЦР-продукту, в то время как в случае ди- и тригеномных видов наблюдается, в основном, по две полосы ПЦР-продуктов (рисунок 4). Приблизительные размеры выявленных ампликонов составляют 750, 900 и 1100 п.н. (табл. 3).

1100 п.н.

900 п.н.

750 п.н.

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 M Рисунок 4. ПЦР на ДНК образцов Brassica с праймерами для центромерного гистона Н3. Номера проб и маркр – те же, что на предыдущем рисунке. Образцы были нанесены на два геля.

Из полученных результатов анализов можно сделать вывод, что род Brassica предоставляет богатый практический материал для установления молекулярногенетической эволюции центромерных гистонов Н3 и кодирующих их генов, а также установления возможности регуляции влияния данных белков на механизмы реализации митоза в соматических клетках различных тканей растений, что, в свою очередь, вызывает несомненный практический интерес при проведении генетико-селекционных научноисследовательских работ. Кроме того, дальнейшее понимание различий между центромерными гистонами Н3 у разных видов Brassica может способствовать селекционному процессу, поскольку одна из проблем в такой селекции – стерильность и отсутствие константности у части ценных гибридов из-за нарушений в мейозе.

Таблица 3.

Размеры ампликонов в ПЦР с праймерами для CENH на образцах Brassica и арабидопсиса.

Латинское название культуры Геном Ампликоны, п.н.

Brassica rapa L. subsp. rapa A 9Brassica rapa L. subsp. chinensis (L.) Hanelt var.

А 9communis (N.Tsen & S.N.Lee) Hanelt Brassica rapa L. subsp. pekinensis (Lour.) Hanelt A 9var. glabra E.Regel B Brassica nigra (L.) W.D.J.Koch subsp. nigra var.

11nigra Brassica oleracea L. convar. capitata (L.) Alef. var.

С 7capitata L. f. capitata alba (L.) Duch. ex Lam.

Brassica oleracea L. convar. botrytis (L.) Alef. var.

C 7botrytis L.

Brassica oleracea L. convar. botrytis (L.) Alef. var.

C 7botrytis L.

Brassica oleracea L. convar. acephala (DC.) Alef.

C 7var. gongylodes L.

Brassica oleracea L. convar. acephala DC. var.

C 7gemmifera DC.

Brassica oleracea L. convar. acephala (DC.) Alef.

C 7var. sabellica L.

АB Brassica juncea (L.) Czern. 750, 9Brassica napus L. subsp. oleifera f. Annua АС (Schuebl.&Mart.) Thell. “Janetzkis 7Weihenstephaner” BC Brassica carinata A.Braun 750, 11Brassica composita АBC 750, 9– Arabidopsis thaliana 135Кроме того, можно предположить, что исследование широкого круга образцов Brassica – а также некоторых других представителей семейства Brassicaceae, используемых для разработки межвидовых гибридов, например, рода Raphanus – позволит выявить многообразие центромерных гистонов Н3, обладающих разными свойствами как в митозе, так и в мейозе и разной сочетаемостью в полигеномных организмах.

Полученные нами данные служат предпосылкой для дальнейших исследований центромерных гистонов Н3 у видов рода Brassica и близких ей видов по следующим направлениям: секвенирование мРНК этих белков и установление их аминокислотной последовательности; выявление гистонов, транслирующихся и встраивающихся в хроматин у полигеномных образцов; проявление нескольких вариантов гистона в полигеномных образцах в митозе и мейозе. Кроме того, значительный интерес представляет вопрос, сказывается ли разница между вариантами этого гистона на жизнеспособности организмов.

Молекулярно-генетическое древо гистона CENHДля того, чтобы установить филогенетическо-эволюционные взаимосвязи между центромерными гистонами Н3 у растений, мы провели поиск растительных белков, ортологичных гистону CENH3 арабидопсиса, в базах данных NCBI и TIGR. В результате проведенного исследования было обнаружено более 30-ти гистонов CENH3 у более чем 20 видов растений, принадлежащих к разным семействам.

В целом, в построенном нами молекулярно-генетическом древе (рис. 5) выделяются три основные группы растений: водоросли, однодольные и двудольные, что соответствует общепринятой ботанической номенклатуре. Взаимное расположение в древе белков этих групп, а также референтных белков человека и дрожжей, в целом соответствует современным представлениям о природной эволюции. В большинстве случаев нам удалось обнаружить только один гистон CENH3 у определнного вида растений; присутствие нескольких гистонов CENH3 в некоторых случаях может отражать полиплоидность вида, например: Arabis hirsuta, Cardamine flexuosa, Olimarabidopsis pumila (Hall et al., 2002). Большинство растений, у которых были выявлены гистоны CENH3, принадлежат к семейству Brassicaceae, это обусловлено широким использованием растений этого семейства для сравнительно-генетических исследований на основе хорошей изученности арабидопсиса.

Любопытно отметить, что у Luzula nivea гистон CENH3 не соответствует гистонам CENH3 у других однодольных. Род Luzula (ожика) широко известен своими диффузными хромосомами с CENH3-содержащими нуклеосомами, расположенными по всей длине хромосом (Nagaki et al., 2005), что привело к значительному кариотипическому разнообразию в пределах рода. По-видимому, выпадение гистона CENH3 ожики из общего филогенетического древа обусловлено очень быстрой эволюцией данного белка.

Согласно современным представлениям, естественный отбор центромерных гистонов Н3 осуществляется в метафазе первого мейотического деления оогенеза, когда наиболее «сильные» центромерные комплексы обеспечивают своим хромосомам Arabidopsis halleri dbj|BAC79428.1| 19.pro Arabidopsis arenosa gb|AAL86776.1|AF465801_20.pro Arabidopsis lyrata gb|AAT96392.1| 18.pro Arabidopsis thaliana AT1G013at.pro Turritis glabra dbj|BAC79432.1| 22.pro Arabis drummondii gb|AAT96397.1| 29.pro Olimarabidopsis pumila dbj|BAF49718.1| 26.pro Olimarabidopsis pumila dbj|BAF49717.1| 44.pro Capsella bursa-pastoris dbj|BAF49725.1| 27.pro Capsella bursa-pastoris dbj|BAF49726.1| 45.pro Crucihimalaya himalaica gb|AAT96391.1| 24.pro Cardamine flexuosa dbj|BAF49723.1| 40.pro Cardamine flexuosa dbj|BAF49722.1| 41.pro Cardamine flexuosa dbj|BAF49721.1| 42.pro Cardamine flexuosa dbj|BAF49724.1| 21.pro Lepidium virginicum dbj|BAF49731.1| 23.pro Lepidium virginicum dbj|BAF49732.1| 43.pro Arabis hirsute dbj|BAF49719.1| 25.pro Arabis hirsute dbj|BAF49720.1| 28.pro Eruca sativa dbj|BAF49730.1| 3.pro Brassica juncea dbj|BAF49728.1| 1.pro Brassica juncea dbj|BAF49729.1| 2.pro Brassica napus TA35045_3708 (TIGR) 53.pro Brassica oleracea dbj|BAF63143.1| 4.pro Raphanus sativus dbj|BAF49733.1| 5.pro Raphanus sativus dbj|BAF49734.1| 6.pro Vitis vinifera emb|CAO39740.1| 7.pro Saccharum officinarum CA127251.pro Saccharum officinarum TC19052.pro Zea mays 54259.pro Oryza sativa Os05g048988.pro Luzula nivea dbj|BAE02657.1| 30.pro Ostreococcus lucimarinus 4999931.pro Chlamydomonas reinhardtii 5723501 HTV32.pro Chlamydomonas reinhardtii 5725316 HTV34.pro Homo sapiens P49456.pro Saccharomyces cerevisiae NC_001143.57.pro 118.100 80 60 40 20 Amino Acid Substitutions (x100) Рисунок 5. Молекулярно-генетическое древо для консервативной части CENH3.

Указаны генные идентификационные номера, или генные локусы, или номера образцов в базах данных NCBI и TIGR. Для каждой пары ветвей сумма длин сплошных линий указывает на количество аминокислотных изменений на 100 аминокислот. Пунктирные линии служат для выравнивания правого края молекулярно-генетического древа.

предпочтительную ориентацию с последующим превращением соответствующего продукта мейоза в женскую гамету (Malik, Henikoff, 2001). Обнаружение значительной разницы центромерного гистона Н3 у рода Luzula с другими высшими растениями указывает, что существенное различие между высшими растениями по способности их центромерных гистонов Н3 встраиваться в хромосомы по разной длине основывается на разнице в аминокислотной структуре этих гистонов.

Нам удалось обнаружить четыре различных гомолога CENH3 у видов рода Brassica: по одному белку у видов B. oleracea и B. napus и два белка у вида B. juncea.

Таким образом, у рода Brassica на три моногенома – A, B и C – приходятся четыре различных известных CENH3-подобных белка, что указывает на существование разных вариантов гистона CENH3 в пределах, по крайней мере, одного из моногеномов.

ВЫВОДЫ 1. Впервые на растительном объекте (Arabidopsis thaliana) методом связывания in vitro показано, что гистон СЕNH3 взаимодействует со следующими белками: 1) протеин, подобный фактору, связывающему ДНК, поврежднную ультрафиолетом (кодирующий ген -- AT4G05420), 2) представитель семейства основных спираль-петля-спираль (bHLH) белков (кодирующий ген -- AT5G01310), 3) белок из семейства FAD-зависимых оксидоредуктаз (кодирующий ген -- AT2G22650), 4) предполагаемая протеин-киназа (кодирующий ген -- AT3G09830), 5) предполагаемая протеин-киназа (кодирующий ген -- AT2G28940), 6) предполагаемый поли-A-связывающий белок (кодирующий ген -- AT2G24350), 7) белок, содержащий РНК-узнающий мотив, (кодирующий ген --AT4G17720).

2. На модельном объекте Arabidopsis thaliana показано, что взаимодействующие партнры гистона СЕNH3 тканеспецифичны.

3. Согласно результатам киназной реакции in vitro, аврора 1 Arabidopsis thaliana фосфорилирует гистон CENH3. Этот факт, впервые установленный на растительном объекте, указывает на значение данной модификации гистона СЕNH3 для запуска и поддержания процессов деления клеток.

4. Согласно результатам ПЦР, у видов B. rapa, B. nigra, B. oleracea, B. juncea, B. napus, B.

carinata, B. compositа присутствуют гены, кодирующие гомологи авроры 1 Arabidopsis thaliana, что указывает на консервативную роль этой киназы у данных видов.

5. Виды капусты B. rapa, B. nigra, B. oleracea, B. juncea, B. napus, B. carinata, B.

compositа, обладают генами, кодирующими гомологи гистона СЕNH3 Arabidopsis thaliana, что свидетельствует в пользу консервативной роли этих белков у данных видов.

6. Аллополиплоидные виды рода Brassica: B. juncea, B. carinata, B. compositа – обладают несколькими разными генами, кодирующие гистонов СЕNH3.

7. Аминокислотная структура гистонов СЕNH3 у растений семейства Brassicaceae обладает консервативным характером, в связи с чем специфичные ПЦР ампликоны генов CENH3 могут служить молекулярно-генетическими маркерами моногеномных видов рода Brassica.

8. Белки и кодирующие их гены, выявленные в настоящем исследовании, по-видимому, представляют собой лишь часть компонентов растительного центромерного комплекса.

9. Осуществленная идентификация генов CENH3 и авроры 1 у модельного объекта Arabidopsis thaliana позволяет значительно ускорить поиск и идентификацию, а также упростить скрининг генетических ресурсов видов рода Brassica по данным генам.

ПРАКТИЧЕСКИЕ РЕКОМЕНДАЦИИ 1. Для специфической амплификации гистона СЕNH3 у видов рода Brassica использовать следующие праймеры: 5'-ARAGAGATTCGCCAKTTCCAGAAG-3', где R=A/G, K=T/G и 5'-CCATGGTCTGCCTTTTCCTCCAAGCCGGCG-3'.

2. Для специфической амплификации авроры 1 у видов рода Brassica использовать следующие праймеры: 5'-GAATGGCGATCCCTACGGAGACACAAC-3' и 5'AACTCTGTAGATTCCAGAAG-3'.

3. Искать взаимодействующие партнры гистона СЕNH3 у растений методом связывания с рекомбинантным белком СЕNH3 in vitro.

4. При поиске взаимодействующих партнров гистона СЕNH3 у растений семейства Brassicaceae учитывать их тканеспецифичность.

СПИСОК РАБОТ, ОПУБЛИКОВАННЫХ ПО ТЕМЕ ДИССЕРТАЦИИ 1. Власенко Л.П., Чесноков Ю.В. Центромерные белки хромосом у высших растений.

Сельскохозяйственная биология. 2009. № 3, с. 3-12.

2. Власенко Л.П., Чесноков Ю.В. Биохимические методы поиска взаимодействий между белками растений. Сельскохозяйственная биология. 2010. №1, с. 3-12.

3. Houben A., Demidov D., Caperta A.D., Karimi R., Agueci F., Vlasenko L. Phosphorylation of histone H3 in plants - a dynamic affair. Biochim Biophys Acta. 2007. 1769 (5-6): 308-315.

4. Власенко Л.П., Матрос А., Демидов Д.Н., Мокк Х.-П., Хоубен А. Изучение растительных аврор и центромерного гистона Н3 на примере A. thaliana и других видов из семейства Brassicaceae // Материалы докладов Международного симпозиума «Молекулярно-генетические механизмы процессов метаболизма». Studia Universitatis, Кишинв. № 7(17). 2008. с. 149.

5. Vlasenko L.P., Houben A. Identification of plant Aurora regulators and substrates // «3d Plant Science Student Conference», Halle, 2007, р.88.

6. Власенко Л.П., Матрос А., Демидов Д.Н., Мокк Х.-П., Хоубен А. Выделение взаимодействующих партнеров гистона CENP-A и характеристиризация аврора-киназ в Arabidopsis thaliana // Материалы докладов I Международной научно-практической конференции «Современные тенденции в селекции и семеноводстве овощных культур:

Традиции и перспективы». ВНИИССОК, М. 2008. Т.2. с.68-7. Власенко Л.П., Матрос А., Демидов Д.Н., Мокк Х.-П., Хоубен А. Исследование белковых взаимодействий гистона CENH3 и аврор в арабидопсисе // Материалы докладов Международной научно-практической конференции «Вавиловские чтения - 2008», Саратов. 2008. с.10-11.







© 2011 www.dissers.ru - «Бесплатная электронная библиотека»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.